Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8IXH8-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-32 (32) MKPLIWTWSDVEGQRPALLICTAAAGPTQGVK PA
1
33-49 (17) DLEEVPPSAASQSAQAR PA
1
50-64 (15) CALGSWGYGKPFEPR PA
1
68-82 (15) NIHSTPAYPDATMHR PA
1
83-91 (9) QLLAPVEGR PA
3
92-99 (8) MAETLNQK PA
2
100-150 (51) LHVANVLEDDPGYLPHVYSEEGECGGAPSLSSLASLEQELQPDLLDSLGSK PA
2
151-165 (15) ATPFEEIYSESGVPS PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center