Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8IXH8-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-39 (32) HPSLLLLLVLLLWLLQVSIIDSVQQETDDLTK PA
1
56-73 (18) WVITTLELEEEDPGPFPK PA
1
74-115 (42) LIGELFNNMSYNMSLMYLISGPGVDEYPEIGLFSLEDHENGR PA
1
116-124 (9) IYVHRPVDR PA
1
125-139 (15) EMTPSFTVYFDVVER PA
1
144-154 (11) IVDTSLIFNIR PA
1
155-168 (14) ISDVNDHAPQFPEK PA
1
169-214 (46) EFNITVQENQSAGQPIFQMLAVDLDEENTPNSQVLYFLISQTPLLK PA
1
229-246 (18) LSGCLDYETAPQFTLLIR PA
1
249-281 (33) DCGEPSLSSTTTVHVDVQEGNNHRPAFTQENYK PA
1
302-310 (9) DSPFTSAWR PA
1
313-362 (50) FNILHGNEEGHFDISTDPETNEGILNVIKPLDYETRPAQSLIIVVENEER PA
1
377-405 (29) AAASATVSVQVTDANDPPAFHPQSFIVNK PA
1
406-428 (23) EEGARPGTLLGTFNAMDPDSQIR PA
1
429-443 (15) YELVHDPANWVSVDK PA
1
444-456 (13) NSGVVITVEPIDR PA
1
457-503 (47) ESPHVNNSFYVIIIHAVDDGFPPQTATGTLMLFLSDINDNVPTLRPR PA
1
506-550 (45) YMEVCESAVHEPLHIEAEDPDLEPFSDPFTFELDNTWGNAEDTWK PA
1
554-565 (12) NWGQSVELLTLR PA
1
570-581 (12) GNYLVPLFIGDK PA
1
594-637 (44) ICPCASGLTCVELADAEVGLHVGALFPVCAAFVALAVALLFLLR PA
1
638-645 (8) CYFVLEPK PA
1
647-668 (22) HGCSVSNDEGHQTLVMYNAESK PA
1
669-699 (31) GTSAQTWSDVEGQRPALLICTAAAGPTQGVK PA
1
700-716 (17) DLEEVPPSAASQSAQAR PA
1
717-731 (15) CALGSWGYGKPFEPR PA
1
735-749 (15) NIHSTPAYPDATMHR PA
1
750-758 (9) QLLAPVEGR PA
3
759-766 (8) MAETLNQK PA
2
767-817 (51) LHVANVLEDDPGYLPHVYSEEGECGGAPSLSSLASLEQELQPDLLDSLGSK PA
2
818-832 (15) ATPFEEIYSESGVPS PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center