Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8IXH8-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-32 (32) MKPLIWTWSDVEGQRPALLICTAAAGPTQGVK PA
1
33-41 (9) AYPDATMHR PA
1
42-50 (9) QLLAPVEGR PA
3
51-58 (8) MAETLNQK PA
2
59-109 (51) LHVANVLEDDPGYLPHVYSEEGECGGAPSLSSLASLEQELQPDLLDSLGSK PA
2
110-124 (15) ATPFEEIYSESGVPS PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center