Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8IXK0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-54 (54) MENELPVPHTSSSACATSSTSGASSSSGCNNSSSGGSGRPTGPQISVYSGIPDR PA
2
55-66 (12) QTVQVIQQALHR PA
2
67-118 (52) QPSTAAQYLQQMYAAQQQHLMLQTAALQQQHLSSAQLQSLAAVQQASLVSNR PA
2
119-152 (34) QGSTSGSNVSAQAPAQSSSINLAASPAAAQLLNR PA
2
153-189 (37) AQSVNSAAASGIAQQAVLLGNTSSPALTASQAQMYLR PA
2
190-228 (39) AQMLIFTPTATVATVQPELGTGSPARPPTPAQVQNLTLR PA
1
229-269 (41) TQQTPAAAASGPTPTQPVLPSLALKPTPGGSQPLPTPAQSR PA
2
270-292 (23) NTAQASPAGAKPGIADSVMEPHK PA
2
294-307 (14) GDGNSSVPGSMEGR PA
2
313-342 (30) TVPAVAAHPLIAPAYAQLQPHQLLPQPSSK PA
2
343-446 (104) HLQPQFVIQQQPQPQQQQPPPQQSRPVLQAEPHPQLASVSPSVALQPSSEAHAMPLGPVTPALPLQCPTANLHKPGGSQQ
CHPPTPDTGPQNGHPEGVPHTPQR PA
2
448-473 (26) FQHTSAVILQLQPASPPQQCVPDDWK PA
1
487-589 (103) SGPSPHQQAIVTAMPGGLPVPTSPNIQPSPAHETGQGIVHALTDLSSPGMTSGNGNSASSIAGTAPQNGENKPPQAIVKP
QILTHVIEGFVIQEGAEPFPVGR PA
2
590-598 (9) SSLLVGNLK PA
4
601-609 (9) YAQGFLPEK PA
4
610-632 (23) LPQQDHTTTTDSEMEEPYLQESK PA
4
660-667 (8) FCSMACAK PA
4
677-684 (8) VGLFHSDR PA
4
690-697 (8) AGAATHNR PA
4
703-710 (8) ASLPPLTK PA
4
715-739 (25) QPTGTVPLSVTAALQLTHSQEDSSR PA
4
740-761 (22) CSDNSSYEEPLSPISASSSTSR PA
4
768-777 (10) DLELPDMHMR PA
4
778-793 (16) DLVGMGHHFLPSEPTK PA
4
794-804 (11) WNVEDVYEFIR PA
4
805-817 (13) SLPGCQEIAEEFR PA
3
818-830 (13) AQEIDGQALLLLK PA
6
831-841 (11) EDHLMSAMNIK PA
6
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center