Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8IXK0-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-54 (54) MTSGNGNSASSIAGTAPQNGENKPPQAIVKPQILTHVIEGFVIQEGAEPFPVGR PA
0
55-63 (9) SSLLVGNLK PA
4
66-74 (9) YAQGFLPEK PA
4
75-97 (23) LPQQDHTTTTDSEMEEPYLQESK PA
4
125-132 (8) FCSMACAK PA
4
142-149 (8) VGLFHSDR PA
4
155-162 (8) AGAATHNR PA
4
168-175 (8) ASLPPLTK PA
4
180-204 (25) QPTGTVPLSVTAALQLTHSQEDSSR PA
4
205-226 (22) CSDNSSYEEPLSPISASSSTSR PA
4
233-242 (10) DLELPDMHMR PA
4
243-258 (16) DLVGMGHHFLPSEPTK PA
4
259-269 (11) WNVEDVYEFIR PA
4
270-282 (13) SLPGCQEIAEEFR PA
3
283-295 (13) AQEIDGQALLLLK PA
6
296-306 (11) EDHLMSAMNIK PA
6
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center