Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8IXK0-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-54 (54) MENELPVPHTSSSACATSSTSGASSSSGCNNSSSGGSGRPTGPQISVYSGIPDR PA
2
55-66 (12) QTVQVIQQALHR PA
2
67-118 (52) QPSTAAQYLQQMYAAQQQHLMLQTAALQQQHLSSAQLQSLAAVQQASLVSNR PA
2
119-152 (34) QGSTSGSNVSAQAPAQSSSINLAASPAAAQLLNR PA
2
153-189 (37) AQSVNSAAASGIAQQAVLLGNTSSPALTASQAQMYLR PA
2
190-228 (39) AQMLIFTPTATVATVQPELGTGSPARPPTPAQVQNLTLR PA
1
229-269 (41) TQQTPAAAASGPTPTQPVLPSLALKPTPGGSQPLPTPAQSR PA
2
270-292 (23) NTAQASPAGAKPGIADSVMEPHK PA
2
294-307 (14) GDGNSSVPGSMEGR PA
2
313-342 (30) TVPAVAAHPLIAPAYAQLQPHQLLPQPSSK PA
2
343-446 (104) HLQPQFVIQQQPQPQQQQPPPQQSRPVLQAEPHPQLASVSPSVALQPSSEAHAMPLGPVTPALPLQCPTANLHKPGGSQQ
CHPPTPDTGPQNGHPEGVPHTPQR PA
2
448-474 (27) FQHTSAVILQLQPASPVPQQCVPDDWK PA
0
488-590 (103) SGPSPHQQAIVTAMPGGLPVPTSPNIQPSPAHETGQGIVHALTDLSSPGMTSGNGNSASSIAGTAPQNGENKPPQAIVKP
QILTHVIEGFVIQEGAEPFPVGR PA
2
591-599 (9) SSLLVGNLK PA
4
602-610 (9) YAQGFLPEK PA
4
611-633 (23) LPQQDHTTTTDSEMEEPYLQESK PA
4
661-668 (8) FCSMACAK PA
4
678-685 (8) VGLFHSDR PA
4
691-698 (8) AGAATHNR PA
4
704-711 (8) ASLPPLTK PA
4
716-740 (25) QPTGTVPLSVTAALQLTHSQEDSSR PA
4
741-762 (22) CSDNSSYEEPLSPISASSSTSR PA
4
769-778 (10) DLELPDMHMR PA
4
779-794 (16) DLVGMGHHFLPSEPTK PA
4
795-805 (11) WNVEDVYEFIR PA
4
806-818 (13) SLPGCQEIAEEFR PA
3
819-831 (13) AQEIDGQALLLLK PA
6
832-842 (11) EDHLMSAMNIK PA
6
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center