Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8IY92-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-29 (27) LSVNEAQLGFYLGSLSHLSACPGIDPR PA
0
30-39 (10) SSEDQPESLK PA
0
40-52 (13) TGQMMDESDEDFK PA
0
53-61 (9) ELCASFFQR PA
0
79-87 (9) AASNGTQIR PA
0
102-109 (8) TLQGPAEK PA
0
110-119 (10) KPPSGSQAPR PA
0
128-154 (27) WQASEPAHSVNGEGGVLASAPDPPVLR PA
0
155-174 (20) ETAQNTQTGNQQEPSPNLSR PA
0
179-204 (26) ENVPNSDSQPPPSCLTTAVPSPSKPR PA
0
205-212 (8) TAQLVLQR PA
0
226-237 (12) HASEECSLEAAR PA
0
244-278 (35) DPQEEMMAGNVYGLGPPAPESDAAVALTLQQEFAR PA
0
279-291 (13) VGASAHDDSLEEK PA
0
292-301 (10) GLFFCQICQK PA
0
302-310 (9) NLSAMNVTR PA
0
325-347 (23) TLRPSVPQIPECPICGKPFLTLK PA
1
360-372 (13) MEVGPQLLLQAVR PA
1
373-394 (22) LQTAQPEGSSSPPMFSFSDHSR PA
1
413-429 (17) VDEAPSEDLLVAMALSR PA
1
430-442 (13) SEMEPGAAVPALR PA
1
443-450 (8) LESAFSER PA
1
451-458 (8) IRPEAENK PA
1
463-481 (19) KPPVSPPLLLVQDSETTGR PA
1
487-507 (21) VALLLSEEVELSSTPPLPASR PA
1
516-525 (10) AGQCPPPPER PA
1
527-549 (23) QSFLWEGSALTGAWAMEDFYTAR PA
1
550-582 (33) LVPPLVPQRPAQGLMQEPVPPLVPPEHSELSER PA
1
584-598 (15) SPALHGTPTAGCGSR PA
1
599-607 (9) GPSPSASQR PA
1
608-620 (13) EHQALQDLVDLAR PA
1
621-662 (42) EGLSASPWPGSGGLAGSEGTAGLDVVPGGLPLTGFVVPSQDK PA
1
670-707 (38) TLLSLGLLVADFGAMVNNPHLSDVQFQTDSGEVLYAHK PA
1
714-737 (24) CPLLIQYVNNEGFSAVEDGVLTQR PA
1
738-749 (12) VLLGDVSTEAAR PA
1
750-776 (27) TFLHYLYTADTGLPPGLSSELSSLAHR PA
1
777-803 (27) FGVSELVHLCEQVPIATDSEGKPWEEK PA
1
804-811 (8) EAENCESR PA
1
812-820 (9) AENFQELLR PA
1
821-835 (15) SMWADEEEEAETLLK PA
1
838-862 (25) DHEEDQENVNEAEMEEIYEFAATQR PA
1
870-898 (29) AAGAGEDADWLEGGSPVSGQLLAGVQVQK PA
1
903-913 (11) VEEMEPLEPGR PA
1
914-922 (9) DEAATTWEK PA
1
923-939 (17) MGQCALPPPQGQHSGAR PA
1
940-963 (24) GAEAPEQEAPEEALGHSSCSSPSR PA
1
971-1012 (42) EGSLPHSDDAGDYEQLFSSTQGEISEPSQITSEPEEQSGAVR PA
1
1022-1034 (13) LAPWQASPPHPCR PA
1
1035-1046 (12) FLLGPPQGGSPR PA
1
1047-1060 (14) GSHHTSGSSLSTPR PA
1
1063-1081 (19) GGTSQVGSPTLLSPAVPSK PA
1
1113-1120 (8) GVLMFPEK PA
1
1121-1137 (17) SPSIDLTQSNPDHSSSR PA
1
1145-1167 (23) LNEEDEVILLLDSDEELELEQTK PA
1
1170-1179 (10) SISSDPLEEK PA
1
1188-1209 (22) SCELFSIIDVDADQEPSQSPPR PA
1
1210-1226 (17) SEAVLQQEDEGALPENR PA
1
1233-1241 (9) GAPWLFCDR PA
1
1242-1265 (24) ESSPSEASTTDTSWLVPATPLASR PA
1
1268-1279 (12) DCSSQTQISSLR PA
1
1280-1293 (14) SGLAVQAVTQHTPR PA
1
1300-1307 (8) EGNEVAQK PA
1
1308-1336 (29) FSVIRPQTPPPQTPSSCLTPVSPGTSDGR PA
1
1342-1366 (25) SPSRPHPGGHPHSSPLAPHPISGDR PA
1
1376-1411 (36) HSPPGPSFLNQTPAGEVVEVGDSDDEQEVASHQANR PA
1
1412-1445 (34) SPPLDSDPPIPIDDCCWHMEPLSPIPIDHWNLER PA
1
1446-1456 (11) TGPLSTSSPSR PA
1
1458-1465 (8) MNEAADSR PA
1
1469-1479 (11) SPGLLDTTPIR PA
1
1492-1546 (55) SSGAGSLGNSRPSFLNSALWDVWDGEEQRPPETPPPAQMPSAGGAQKPEGLETPK PA
1
1558-1575 (18) VPITPMPQYSIMETPVLK PA
1
1581-1588 (8) FGVRPLPK PA
1
1597-1638 (42) EIFQYTHQTLDSDSEDESQSSQPLLQAPHCQTLASQTYKPSR PA
1
1639-1657 (19) AGVHAQQEATTGPGAHRPK PA
1
1671-1680 (10) HHESITPPSR PA
1
1685-1757 (73) EAPPGLNDDAQIPASQESVATSVDGSDSSLSSQSSSSCEFGAAFESAGEEEGEGEVSASQAAVQAADTDEALR PA
1
1762-1769 (8) SKPALYQK PA
1
1770-1779 (10) VLLYQPFELR PA
1
1797-1814 (18) LLDFLDTHCITFTTAATR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center