Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8IY92-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
13-35 (23) TLRPSVPQIPECPICGKPFLTLK PA
1
48-60 (13) MEVGPQLLLQAVR PA
1
61-82 (22) LQTAQPEGSSSPPMFSFSDHSR PA
1
101-117 (17) VDEAPSEDLLVAMALSR PA
1
118-130 (13) SEMEPGAAVPALR PA
1
131-138 (8) LESAFSER PA
1
139-146 (8) IRPEAENK PA
1
151-169 (19) KPPVSPPLLLVQDSETTGR PA
1
175-195 (21) VALLLSEEVELSSTPPLPASR PA
1
204-213 (10) AGQCPPPPER PA
1
215-237 (23) QSFLWEGSALTGAWAMEDFYTAR PA
1
238-270 (33) LVPPLVPQRPAQGLMQEPVPPLVPPEHSELSER PA
1
272-286 (15) SPALHGTPTAGCGSR PA
1
287-295 (9) GPSPSASQR PA
1
296-308 (13) EHQALQDLVDLAR PA
1
309-350 (42) EGLSASPWPGSGGLAGSEGTAGLDVVPGGLPLTGFVVPSQDK PA
1
358-395 (38) TLLSLGLLVADFGAMVNNPHLSDVQFQTDSGEVLYAHK PA
1
402-425 (24) CPLLIQYVNNEGFSAVEDGVLTQR PA
1
426-437 (12) VLLGDVSTEAAR PA
1
438-464 (27) TFLHYLYTADTGLPPGLSSELSSLAHR PA
1
465-491 (27) FGVSELVHLCEQVPIATDSEGKPWEEK PA
1
492-499 (8) EAENCESR PA
1
500-508 (9) AENFQELLR PA
1
509-523 (15) SMWADEEEEAETLLK PA
1
526-550 (25) DHEEDQENVNEAEMEEIYEFAATQR PA
1
558-586 (29) AAGAGEDADWLEGGSPVSGQLLAGVQVQK PA
1
591-601 (11) VEEMEPLEPGR PA
1
602-610 (9) DEAATTWEK PA
1
611-627 (17) MGQCALPPPQGQHSGAR PA
1
628-651 (24) GAEAPEQEAPEEALGHSSCSSPSR PA
1
659-700 (42) EGSLPHSDDAGDYEQLFSSTQGEISEPSQITSEPEEQSGAVR PA
1
710-722 (13) LAPWQASPPHPCR PA
1
723-734 (12) FLLGPPQGGSPR PA
1
735-748 (14) GSHHTSGSSLSTPR PA
1
751-769 (19) GGTSQVGSPTLLSPAVPSK PA
1
801-808 (8) GVLMFPEK PA
1
809-825 (17) SPSIDLTQSNPDHSSSR PA
1
833-855 (23) LNEEDEVILLLDSDEELELEQTK PA
1
858-867 (10) SISSDPLEEK PA
1
876-897 (22) SCELFSIIDVDADQEPSQSPPR PA
1
898-914 (17) SEAVLQQEDEGALPENR PA
1
921-929 (9) GAPWLFCDR PA
1
930-953 (24) ESSPSEASTTDTSWLVPATPLASR PA
1
956-967 (12) DCSSQTQISSLR PA
1
968-981 (14) SGLAVQAVTQHTPR PA
1
988-995 (8) EGNEVAQK PA
1
996-1024 (29) FSVIRPQTPPPQTPSSCLTPVSPGTSDGR PA
1
1030-1054 (25) SPSRPHPGGHPHSSPLAPHPISGDR PA
1
1064-1099 (36) HSPPGPSFLNQTPAGEVVEVGDSDDEQEVASHQANR PA
1
1100-1133 (34) SPPLDSDPPIPIDDCCWHMEPLSPIPIDHWNLER PA
1
1134-1144 (11) TGPLSTSSPSR PA
1
1146-1153 (8) MNEAADSR PA
1
1157-1167 (11) SPGLLDTTPIR PA
1
1180-1234 (55) SSGAGSLGNSRPSFLNSALWDVWDGEEQRPPETPPPAQMPSAGGAQKPEGLETPK PA
1
1246-1263 (18) VPITPMPQYSIMETPVLK PA
1
1269-1276 (8) FGVRPLPK PA
1
1285-1326 (42) EIFQYTHQTLDSDSEDESQSSQPLLQAPHCQTLASQTYKPSR PA
1
1327-1345 (19) AGVHAQQEATTGPGAHRPK PA
1
1359-1368 (10) HHESITPPSR PA
1
1373-1445 (73) EAPPGLNDDAQIPASQESVATSVDGSDSSLSSQSSSSCEFGAAFESAGEEEGEGEVSASQAAVQAADTDEALR PA
1
1450-1457 (8) SKPALYQK PA
1
1458-1467 (10) VLLYQPFELR PA
1
1485-1502 (18) LLDFLDTHCITFTTAATR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center