Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8IYI0-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-27 (23) DATSGSLSEESSALDLPSACDIR PA
1
28-84 (57) DYVLQGPSQEANSEAFSSLEFHSFPYSSDVDPDTSNLNIEQNNSWTAENFWLDPAVK PA
1
102-123 (22) FYEMFGHPQPGSANSLSASVCK PA
1
140-149 (10) YALLQQNVMK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center