Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N109-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-41 (41) MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPR PA
1
42-50 (9) GGHVTLLCR PA
1
53-62 (10) LGFTIFSLYK PA
1
63-74 (12) EDGVPVPELYNK PA
1
79-94 (16) SILMGPVTPAHAGTYR PA
1
102-135 (34) SPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVR PA
1
136-147 (12) TGENVTLSCSSR PA
0
148-157 (10) SSFDMYHLSR PA
1
166-232 (67) LPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSK PA
0
238-267 (30) HLHILIGTSVAIILFIILFFFLLHCCCSNK PA
1
269-281 (13) NAAVMDQEPAGDR PA
2
286-310 (25) EDSDDQDPQEVTYAQLDHCVFTQTK PA
1
311-319 (9) ITSPSQRPK PA
1
320-337 (18) TPPTDTTMYMELPNAKPR PA
1
356-364 (9) ETTALSQNR PA
1
365-375 (11) VASSHVPAAGI PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center