Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N1T3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MEGALTAR PA
1
11-33 (23) VGVQDFVLLDAYTSESAFVDNLR PA
1
36-90 (55) FSENLIYTYIGTLLVSVNPYQELGIYTVSQMELYQGVNFFELPPHVYAIADNAYR PA
1
91-111 (21) MMCAELNNHFILISGESGAGK PA
1
118-136 (19) ILEYFAVTCPMTQSLQIAR PA
1
139-153 (15) LLFSNPVLEAFGNAR PA
1
166-189 (24) YMDIQFDFQGIPVGGHIISYLIEK PA
1
192-200 (9) VVYQNEGER PA
1
201-216 (16) NFHIFYQLLAGGEEER PA
1
217-224 (8) LSYLGLER PA
1
231-239 (9) YLSQGHCAK PA
1
251-301 (51) TVSNAFSVIDFTEADLENLFGIIASVLHLGNIGFEEDDQGCATIPDTHEIK PA
1
306-321 (16) LLGVHPSVLLEALTHR PA
1
327-343 (17) TEEVICPLTLELSVYAR PA
1
354-361 (8) TFTWLVNK PA
1
362-369 (8) INSSLVNK PA
1
374-384 (11) ILDPLLLLTWK PA
0
385-400 (16) TVIGLLDIYGFEVFDK PA
1
401-414 (14) NGFEQFCINYCNEK PA
1
415-422 (8) LQQLLIER PA
1
426-442 (17) AEQAEYEMEGIEWEPIK PA
1
448-456 (9) IICDLVEER PA
1
459-482 (24) GIISILDEECIRPGPATDLSFLEK PA
1
514-526 (13) LLHYAGEVTYCTK PA
1
554-564 (11) ECFLLAELENR PA
1
566-575 (10) RPPTVGTQFK PA
1
576-588 (13) NSLSSLLETLISK PA
1
618-626 (9) YLGLMEHLR PA
1
647-666 (20) SLCPDTWPHWHGPPAEGVER PA
1
670-679 (10) YIGYKPEEYK PA
1
692-704 (13) TLFATEDAFEFSK PA
1
768-783 (16) NKPLCPDNEEFIVFVR PA
1
802-818 (17) SWLRPPGILENASDLLR PA
1
845-852 (8) VVTSEIFR PA
2
856-870 (15) DGYTESLNQPFVNSR PA
2
871-879 (9) IDEGDINPK PA
2
880-888 (9) VLQLISHEK PA
2
889-897 (9) IQYGVPVIK PA
2
916-924 (9) AAYVVELAK PA
2
936-957 (22) GVSTSNLSDGILVIHVSPEDSK PA
1
960-975 (16) GDAVLQCGHVFEAVTK PA
1
983-1001 (19) ENIVNVVQGSLQFFISPGK PA
1
1002-1017 (16) EGTIVFDTGLEEQVYK PA
1
1020-1029 (10) NGQLTVVSVR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center