Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N1T3-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MEGALTAR PA
1
11-33 (23) VGVQDFVLLDAYTSESAFVDNLR PA
1
36-90 (55) FSENLIYTYIGTLLVSVNPYQELGIYTVSQMELYQGVNFFELPPHVYAIADNAYR PA
1
91-111 (21) MMCAELNNHFILISGESGAGK PA
1
118-136 (19) ILEYFAVTCPMTQSLQIAR PA
1
139-153 (15) LLFSNPVLEAFGNAR PA
1
166-189 (24) YMDIQFDFQGIPVGGHIISYLIEK PA
1
192-200 (9) VVYQNEGER PA
1
201-216 (16) NFHIFYQLLAGGEEER PA
1
217-224 (8) LSYLGLER PA
1
231-239 (9) YLSQGHCAK PA
1
251-301 (51) TVSNAFSVIDFTEADLENLFGIIASVLHLGNIGFEEDDQGCATIPDTHEIK PA
1
306-321 (16) LLGVHPSVLLEALTHR PA
1
327-343 (17) TEEVICPLTLELSVYAR PA
1
354-361 (8) TFTWLVNK PA
1
362-369 (8) INSSLVNK PA
1
375-390 (16) TVIGLLDIYGFEVFDK PA
1
391-404 (14) NGFEQFCINYCNEK PA
1
405-412 (8) LQQLLIER PA
1
416-432 (17) AEQAEYEMEGIEWEPIK PA
1
438-446 (9) IICDLVEER PA
1
449-472 (24) GIISILDEECIRPGPATDLSFLEK PA
1
504-516 (13) LLHYAGEVTYCTK PA
1
544-554 (11) ECFLLAELENR PA
1
556-565 (10) RPPTVGTQFK PA
1
566-578 (13) NSLSSLLETLISK PA
1
608-616 (9) YLGLMEHLR PA
1
637-656 (20) SLCPDTWPHWHGPPAEGVER PA
1
660-669 (10) YIGYKPEEYK PA
1
682-694 (13) TLFATEDAFEFSK PA
1
758-773 (16) NKPLCPDNEEFIVFVR PA
1
792-808 (17) SWLRPPGILENASDLLR PA
1
835-842 (8) VVTSEIFR PA
2
846-860 (15) DGYTESLNQPFVNSR PA
2
861-869 (9) IDEGDINPK PA
2
870-878 (9) VLQLISHEK PA
2
879-887 (9) IQYGVPVIK PA
2
906-914 (9) AAYVVELAK PA
2
926-947 (22) GVSTSNLSDGILVIHVSPEDSK PA
1
950-965 (16) GDAVLQCGHVFEAVTK PA
1
973-991 (19) ENIVNVVQGSLQFFISPGK PA
1
992-1007 (16) EGTIVFDTGLEEQVYK PA
1
1010-1019 (10) NGQLTVVSVR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center