Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N2H3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
11-21 (11) AVAASPFPAWR PA
0
29-55 (27) GGLKPEYDAVVIGAGHNGLVAAAYLQR PA
0
56-65 (10) LGVNTAVFER PA
0
67-83 (17) HVIGGAAVTEEIIPGFK PA
0
87-105 (19) ASYLLSLLRPQIYTDLELK PA
0
115-130 (16) NPYSFTPMLEEGAGSK PA
0
134-146 (13) CLLLGTDMAENQK PA
0
147-154 (8) QIAQFSQK PA
0
169-195 (27) LALAIDPLLDAAPVDMAAFQHGSLLQR PA
0
198-207 (10) SLSTLKPLLK PA
0
211-218 (8) ILGAQLPR PA
0
219-229 (11) YYEVLTAPITK PA
0
230-241 (12) VLDQWFESEPLK PA
0
242-309 (68) ATLATDAVIGAMTSPHTPGSGYVLLHHVMGGLEGMQGAWGYVQGGMGALSDAIASSATTHGASIFTEK PA
0
314-334 (21) VQVNSEGCVQGVVLEDGTEVR PA
0
337-350 (14) MVLSNTSPQITFLK PA
0
351-364 (14) LTPQEWLPEEFLER PA
0
384-395 (12) LPSFLAAPNAPR PA
0
396-469 (74) GQPLPHHQCSIHLNCEDTLLLHQAFEDAMDGLPSHRPVIELCIPSSLDPTLAPPGCHVVSLFTQYMPYTLAGGK PA
0
483-495 (13) VFDCIEVYAPGFK PA
0
502-511 (10) DILTPPDLER PA
0
512-543 (32) IFGLPGGNIFHCAMSLDQLYFARPVPLHSGYR PA
0
544-568 (25) CPLQGLYLCGSGAHPGGGVMGAAGR PA
0
569-576 (8) NAAHVAFR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center