Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N2I2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-22 (22) MGQPAPYAEGPIQGGDAGELCK PA
0
23-35 (13) CDFLVSISIPQTR PA
0
36-43 (8) SDIPAGAR PA
0
51-58 (8) SLDTCWGR PA
0
67-77 (11) LECNGVIFTHR PA
0
78-85 (8) NLCLPGGK PA
0
94-101 (8) TAQLNISK PA
3
108-124 (17) LIVEGLLMDVPQHPDFK PA
3
130-138 (9) SQLHDTGNK PA
3
141-159 (19) IGDCTDLTVQDHESSTTER PA
3
166-178 (13) LEESSVSTHLITK PA
3
190-208 (19) CGECGSYYNPHSDFHLHQR PA
3
209-219 (11) VHTNEKPYTCK PA
3
237-264 (28) IHTGEKPYSCEECGQAFSQNSHLLQHQK PA
3
265-279 (15) LHGGQRPYECTDCGK PA
3
293-301 (9) IHTGEKPFK PA
44
308-320 (13) AFSCSYDCIIHER PA
3
321-331 (11) IHNGEKPYECK PA
5
336-348 (13) SLSSNSVLIQHQR PA
3
349-359 (11) IHTGEKPYECK PA
82
368-376 (9) SSVFLQHQR PA
3
377-385 (9) FHTGEQLYK PA
3
405-419 (15) IHNGEKPYECQECGK PA
3
425-432 (8) ITLVQHQR PA
3
433-443 (11) VHTGEKPYECK PA
23
451-460 (10) WNASFIQHQK PA
3
467-527 (61) LINGTGLSAVKPYCPCAILSPLPPQHTCSALAPPGPPLSSSHAVVLPPSVPFFLLLPSSEK PA
3
528-547 (20) ANPSPVQIAHFFQDLAFPGK PA
3
548-560 (13) SSLQSPNPLSHSL PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center