Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N2I2-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-50 (50) MKPGVISHAPDSVVPAAFPFPKPDLIFQLEQGEAAWGPDPWTLAGGEALR PA
0
66-73 (8) TAQLNISK PA
3
80-96 (17) LIVEGLLMDVPQHPDFK PA
3
102-110 (9) SQLHDTGNK PA
3
113-131 (19) IGDCTDLTVQDHESSTTER PA
3
138-150 (13) LEESSVSTHLITK PA
3
162-180 (19) CGECGSYYNPHSDFHLHQR PA
3
181-191 (11) VHTNEKPYTCK PA
3
209-236 (28) IHTGEKPYSCEECGQAFSQNSHLLQHQK PA
3
237-251 (15) LHGGQRPYECTDCGK PA
3
265-273 (9) IHTGEKPFK PA
44
280-292 (13) AFSCSYDCIIHER PA
3
293-303 (11) IHNGEKPYECK PA
5
308-320 (13) SLSSNSVLIQHQR PA
3
321-331 (11) IHTGEKPYECK PA
82
340-348 (9) SSVFLQHQR PA
3
349-357 (9) FHTGEQLYK PA
3
377-391 (15) IHNGEKPYECQECGK PA
3
397-404 (8) ITLVQHQR PA
3
405-415 (11) VHTGEKPYECK PA
23
423-432 (10) WNASFIQHQK PA
3
439-499 (61) LINGTGLSAVKPYCPCAILSPLPPQHTCSALAPPGPPLSSSHAVVLPPSVPFFLLLPSSEK PA
3
500-519 (20) ANPSPVQIAHFFQDLAFPGK PA
3
520-532 (13) SSLQSPNPLSHSL PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center