Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N2I2-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-12 (12) MLQTVWFQGLGR PA
1
13-42 (30) NLLFQEPVTFEDVAVYFTQNEWASLHPTQR PA
1
47-94 (48) EVMLENYANVTSLSAFPFPKPDLIFQLEQGEAAWGPDPWTLAGGEALR PA
0
110-117 (8) TAQLNISK PA
3
124-140 (17) LIVEGLLMDVPQHPDFK PA
3
146-154 (9) SQLHDTGNK PA
3
157-175 (19) IGDCTDLTVQDHESSTTER PA
3
182-194 (13) LEESSVSTHLITK PA
3
206-224 (19) CGECGSYYNPHSDFHLHQR PA
3
225-235 (11) VHTNEKPYTCK PA
3
253-280 (28) IHTGEKPYSCEECGQAFSQNSHLLQHQK PA
3
281-295 (15) LHGGQRPYECTDCGK PA
3
309-317 (9) IHTGEKPFK PA
44
324-336 (13) AFSCSYDCIIHER PA
3
337-347 (11) IHNGEKPYECK PA
5
352-364 (13) SLSSNSVLIQHQR PA
3
365-375 (11) IHTGEKPYECK PA
82
384-392 (9) SSVFLQHQR PA
3
393-401 (9) FHTGEQLYK PA
3
421-435 (15) IHNGEKPYECQECGK PA
3
441-448 (8) ITLVQHQR PA
3
449-459 (11) VHTGEKPYECK PA
23
467-476 (10) WNASFIQHQK PA
3
483-543 (61) LINGTGLSAVKPYCPCAILSPLPPQHTCSALAPPGPPLSSSHAVVLPPSVPFFLLLPSSEK PA
3
544-563 (20) ANPSPVQIAHFFQDLAFPGK PA
3
564-576 (13) SSLQSPNPLSHSL PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center