Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N2I2-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-12 (12) MLQTVWFQGLGR PA
1
13-42 (30) NLLFQEPVTFEDVAVYFTQNEWASLHPTQR PA
1
47-72 (26) EVMLENYANVTSLYPTAGGFPLDTER PA
0
76-134 (59) VPGALSSFLPSSSSLELILALLPMSAFPFPKPDLIFQLEQGEAAWGPDPWTLAGGEALR PA
0
150-157 (8) TAQLNISK PA
3
164-180 (17) LIVEGLLMDVPQHPDFK PA
3
186-194 (9) SQLHDTGNK PA
3
197-215 (19) IGDCTDLTVQDHESSTTER PA
3
222-234 (13) LEESSVSTHLITK PA
3
246-264 (19) CGECGSYYNPHSDFHLHQR PA
3
265-275 (11) VHTNEKPYTCK PA
3
293-320 (28) IHTGEKPYSCEECGQAFSQNSHLLQHQK PA
3
321-335 (15) LHGGQRPYECTDCGK PA
3
349-357 (9) IHTGEKPFK PA
44
364-376 (13) AFSCSYDCIIHER PA
3
377-387 (11) IHNGEKPYECK PA
5
392-404 (13) SLSSNSVLIQHQR PA
3
405-415 (11) IHTGEKPYECK PA
82
424-432 (9) SSVFLQHQR PA
3
433-441 (9) FHTGEQLYK PA
3
461-475 (15) IHNGEKPYECQECGK PA
3
481-488 (8) ITLVQHQR PA
3
489-499 (11) VHTGEKPYECK PA
23
507-516 (10) WNASFIQHQK PA
3
523-583 (61) LINGTGLSAVKPYCPCAILSPLPPQHTCSALAPPGPPLSSSHAVVLPPSVPFFLLLPSSEK PA
3
584-603 (20) ANPSPVQIAHFFQDLAFPGK PA
3
604-616 (13) SSLQSPNPLSHSL PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center