Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N2U9-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-38 (38) MEAEGLDWLLVPLHQLVSWGAAAAMVFGGVVPYVPQYR PA
2
43-64 (22) TQNADGFSTYVCLVLLVANILR PA
2
73-93 (21) FESPLLWQSAIMILTMLLMLK PA
2
100-107 (8) VANELNAR PA
2
110-117 (8) SFTAADSK PA
0
128-192 (65) SFLDFDPHHFWQWSSFSDYVQCVLAFTGVAGYITYLSIDSALFVETLGFLAVLTEAMLGVPQLYR PA
0
196-205 (10) HQSTEGMSIK PA
1
206-217 (12) MVLMWTSGDAFK PA
1
225-253 (29) GAPLQFSVCGLLQVLVDLAILGQAYAFAR PA
1
254-269 (16) HPQKPAPHAVHPTGTK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center