Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N3J2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-21 (21) MSVVHQLSAGWLLDHLSFINK PA
0
22-35 (14) INYQLHQHHEPCCR PA
0
38-84 (47) EFTTSVHFESLQMDSVSSSGVCAAFIASDSSTKPENDDGGNYEMFTR PA
0
86-106 (21) FVFRPELFDVTKPYITPAVHK PA
0
107-114 (8) ECQQSNEK PA
0
115-122 (8) EDLMNGVK PA
0
124-132 (9) EISISIIGK PA
0
137-153 (17) CVVFNQGELDAMEYHTK PA
0
156-171 (16) ELILDGSLQLIQEGLK PA
0
172-181 (10) SGFLYPLFEK PA
0
185-206 (22) GSKPITLPLDACSLSELCEMAK PA
0
207-236 (30) HLPSLNEMEHQTLQLVEEDTSVTEQDLFLR PA
0
237-246 (10) VVENNSSFTK PA
0
247-254 (8) VITLMGQK PA
0
261-278 (18) SSFLLSDISCMQPLLNYR PA
0
280-293 (14) TFDVIVIDPPWQNK PA
0
301-316 (16) YSYLSPLQIQQIPIPK PA
0
317-331 (15) LAAPNCLLVTWVTNR PA
0
340-358 (19) EELYPSWSVEVVAEWHWVK PA
0
359-374 (16) ITNSGEFVFPLDSPHK PA
0
375-384 (10) KPYEGLILGR PA
0
395-407 (13) NADVNVLPIPDHK PA
0
408-428 (21) LIVSVPCTLHSHKPPLAEVLK PA
0
429-443 (15) DYIKPDGEYLELFAR PA
0
444-458 (15) NLQPGWTSWGNEVLK PA
0
459-472 (14) FQHVDYFIAVESGS PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center