Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N3T1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
14-50 (37) LQFLLLLLMLGCVLMMVAMLHPPHHTLHQTVTAQASK PA
0
59-91 (33) LDFGESQDWVLEAEDEGEEYSPLEGLPPFISLR PA
0
92-105 (14) EDQLLVAVALPQAR PA
0
134-157 (24) DWGADEDGEVSEEEELTPFSLDPR PA
0
158-166 (9) GLQEALSAR PA
0
178-209 (32) HPLCLQQHPQDSLPTASVILCFHDEAWSTLLR PA
0
210-220 (11) TVHSILDTVPR PA
0
225-239 (15) EIILVDDLSQQGQLK PA
0
240-248 (9) SALSEYVAR PA
0
274-299 (26) ATGDVLVFMDAHCECHPGWLEPLLSR PA
0
307-318 (12) VVSPVIDVIDWK PA
0
319-326 (8) TFQYYPSK PA
0
337-349 (13) LDFHWEPLPEHVR PA
0
351-360 (10) ALQSPISPIR PA
0
361-373 (13) SPVVPGEVVAMDR PA
0
374-389 (16) HYFQNTGAYDSLMSLR PA
0
390-399 (10) GGENLELSFK PA
0
400-414 (15) AWLCGGSVEILPCSR PA
0
415-435 (21) VGHIYQNQDSHSPLDQEATLR PA
0
440-449 (10) IAETWLGSFK PA
0
455-464 (10) HSPEAFSLSK PA
0
465-473 (9) AEKPDCMER PA
0
484-508 (25) TFHWFLANVYPELYPSEPRPSFSGK PA
0
509-540 (32) LHNTGLGLCADCQAEGDILGCPMVLAPCSDSR PA
0
541-550 (10) QQQYLQHTSR PA
0
552-566 (15) EIHFGSPQHLCFAVR PA
0
567-602 (36) QEQVILQNCTEEGLAIHQQHWDFQENGMIVHILSGK PA
0
603-613 (11) CMEAVVQENNK PA
0
614-623 (10) DLYLRPCDGK PA
0
630-639 (10) FDQINAVDER PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center