Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N5N4-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
17-25 (9) IQAQENFAK PA
1
31-60 (30) LSWLTEPDPEPLQPWEVTNDSNTVQLPLQK PA
1
87-97 (11) TLSQMYTHTGK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center