Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N6L0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-18 (18) MDLPEGPVGGPTAEMYLR PA
0
26-48 (23) LGMPVSLEEQILNSTFEACDPQR PA
0
49-73 (25) TGTVAVAQVLAYLEAVTGQGPQDAR PA
0
74-89 (16) LQTLANSLDPNGEGPK PA
0
90-102 (13) ATVDLDTFLVVMR PA
0
103-129 (27) DWIAACQLHGGLELEEETAFQGALTSR PA
0
130-174 (45) QLPSGCPEAEEPANLESFGGEDPRPELQATADLLSSLEDLELSNR PA
0
186-196 (11) SMETAEEGSAR PA
0
197-205 (9) LGEEILALR PA
0
207-219 (13) QLHSTQQALQFAK PA
0
220-229 (10) AMDEELEDLK PA
0
252-269 (18) EQQHLVAEMETLQEENGK PA
0
281-288 (8) SQELAMEK PA
0
294-305 (12) QLFECEHLICQR PA
0
315-327 (13) DVESLAQTLEEYR PA
0
340-361 (22) LEEQLSQTYEGPDELPEGAQLR PA
0
363-381 (19) VGWTELLPPSLGLEIEAIR PA
0
384-424 (41) QEVATADLSNPLCGVWQWEEVIHETSEETEFPSEAPAGGQR PA
0
425-437 (13) NFQGEPAHPEEGR PA
0
439-446 (8) EPSMWLTR PA
0
448-483 (36) EEEEDAESQVTADLPVPLGAPRPGDIPENPPERPAR PA
0
485-495 (11) ELQQALVPVMK PA
0
504-514 (11) AWGQLCLPPQR PA
0
520-562 (43) HPLIPAPVLGLLLLLLLSVLLLGPSPPPTWPHLQLCYLQPPPV PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center