Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N743-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-50 (50) MSLMVVSMACVGFFLLEGPWPHVGGQDKPFLSAWPGTVVSEGQHVTLQCR PA
0
53-62 (10) LGFNEFSLSK PA
1
63-74 (12) EDGMPVPELYNR PA
1
78-94 (17) NSFLMGPVTPAHAGTYR PA
0
95-122 (28) CCSSHPHSPTGWSAPSNPVVIMVTGVHR PA
0
123-135 (13) KPSLLAHPGPLVK PA
10
136-149 (14) SGETVILQCWSDVR PA
0
158-166 (9) EGITEDPLR PA
0
167-194 (28) LVGQLHDAGSQVNYSMGPMTPALAGTYR PA
0
195-247 (53) CFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENVTLSCSSR PA
0
248-257 (10) SLFDIYHLSR PA
0
258-265 (8) EAEAGELR PA
0
272-292 (21) VNGTFQANFPLGPVTHGGNYR PA
0
299-320 (22) ALPHAWSDPSDPLPVSVTGNSR PA
0
321-345 (25) HLHVLIGTSVVIIPFAILLFFLLHR PA
0
352-364 (13) NAVVMDQEPAGNR PA
2
369-392 (24) EDSDEQDPQEVTYAQLNHCVFTQR PA
2
394-402 (9) ITRPSQRPK PA
7
403-410 (8) TPPTDTSV PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center