Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N7A1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MADSQLFCVAEER PA
0
14-57 (44) SGHCAVVDGNFLYVWGGYVSIEDNEVYLPNDEIWTYDIDSGLWR PA
0
58-80 (23) MHLMEGELPASMSGSCGACINGK PA
0
81-90 (10) LYIFGGYDDK PA
0
105-112 (8) DETYIWEK PA
0
113-124 (12) ITDFEGQPPTPR PA
0
136-145 (10) LIYFGGYGCR PA
0
147-179 (33) HSELQDCFDVHDASWEEQIFWGWHNDVHIFDTK PA
0
180-189 (10) TQTWFQPEIK PA
0
190-197 (8) GGVPPQPR PA
0
198-208 (11) AAHTCAVLGNK PA
0
221-237 (17) MNDLHYLNLDTWTWSGR PA
0
238-246 (9) ITINGESPK PA
0
249-260 (12) SWHTLTPIADDK PA
0
261-288 (28) LFLCGGLSADNIPLSDGWIHNVTTNCWK PA
0
300-308 (9) LWHTACLGK PA
0
309-319 (11) ENEIMVFGGSK PA
0
320-345 (26) DDLLALDTGHCNDLLIFQTQPYSLLR PA
0
346-353 (8) SCLDCIGK PA
0
354-368 (15) NSIMLESQISLLPPK PA
0
377-386 (10) ITFWAAANHR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center