Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N7R1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MGAAAPAESADLGNFWK PA
0
18-35 (18) AGEPLLQGPDALAAPMSR PA
0
36-49 (14) SPSTPQTTPSPQGR PA
0
57-91 (35) SLTQSHIQYFQWGRPVPSTHLIEVRPTQDPAKPQR PA
0
99-110 (12) RPALPGETALGR PA
0
111-121 (11) DLSCAWEGCMK PA
0
133-146 (14) TWSPVTIGIAPPER PA
0
158-175 (18) ARPAGRPAAQELLDPCTR PA
0
176-187 (12) ETLLGALSQCPK PA
0
192-204 (13) FDGPLWFEVSDSK PA
0
209-222 (14) NLQPRPSAFKPLSK PA
0
223-280 (58) NGAVASFVPRPGPLKPSLGPWSLSFCDDAWPSVLVQPAPSAIWDFWEATTPSCGSCSR PA
0
281-296 (16) VSFALEVTQSAGPFGS PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center