Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N7U6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-12 (12) MNMEIGHPHEGK PA
1
26-33 (8) FPMELGIR PA
1
43-52 (10) CGESPVVSNK PA
1
69-76 (8) GLEMGLER PA
1
87-108 (22) GSLGVDSVSASQGTKPSLLPGR PA
1
109-124 (16) MGLENESLLAGYTHER PA
1
125-132 (8) IIQPPLGR PA
1
133-143 (11) VCGSSQAAGSR PA
1
145-168 (24) APLASGPEGVEELVGKPAFVMEPR PA
1
174-187 (14) ESTCVLMKPNTEIK PA
1
188-206 (19) LPVEVDIGLTQAEGPDETK PA
2
207-230 (24) NTEPQMGLVIEPPQCQFAQQHEQR PA
2
232-245 (14) EAGNIESGVEPPDR PA
2
246-253 (8) IRPIYSGK PA
2
258-266 (9) TPCWPSAGK PA
2
274-281 (8) VATCLTEK PA
2
285-292 (8) LITPPEAK PA
2
299-306 (8) YPPAGVER PA
2
312-326 (15) ANDPQIAPYLTHGIR PA
2
329-348 (20) ISVLANTLINPQPITTFQQK PA
2
354-361 (8) ESIYLSNR PA
2
368-377 (10) SHDQAPGLPK PA
2
378-392 (15) GMDTTNTTFGTAVIK PA
2
412-433 (22) EGNEGHDLYVVSHNDYYAGEAK PA
2
437-444 (8) YNPSSFHR PA
2
445-459 (15) CSVYGVPTPHFNDGR PA
2
464-474 (11) SLYWLHELQMK PA
2
498-532 (35) VLDPIAETMNVPPDCTFGACLRPEEYGVGDLIHNR PA
2
563-571 (9) FDTLLAAFR PA
2
584-600 (17) DELQEACDQANLSLDDK PA
1
601-629 (29) LLDQLFDYCDVDNDGFINYLEFANFLNWK PA
1
647-675 (29) KPDCVNPTEANVEEPEQTLLIKPEDIVLK PA
1
686-693 (8) TLLRPSDK PA
1
700-726 (27) TTSSEINAIVGAIPSTCYPICGVPTIR PA
1
741-760 (20) TNYGEEGSAYSLLYPTIFAR PA
1
775-787 (13) EEIAEILCNIGVK PA
1
788-802 (15) LSDEEFENVWNLASK PA
1
807-815 (9) GEVCVENIR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center