Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N7U6-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-49 (43) IDLLGSSDPPTSASQIAETTDVSHHAGLIEFLALSNSSALASR PA
0
50-57 (8) SVEITEIK PA
0
58-76 (19) LPVEVDIGLTQAEGPDETK PA
2
77-100 (24) NTEPQMGLVIEPPQCQFAQQHEQR PA
2
102-115 (14) EAGNIESGVEPPDR PA
2
116-123 (8) IRPIYSGK PA
2
128-136 (9) TPCWPSAGK PA
2
144-151 (8) VATCLTEK PA
2
155-162 (8) LITPPEAK PA
2
169-176 (8) YPPAGVER PA
2
182-196 (15) ANDPQIAPYLTHGIR PA
2
199-218 (20) ISVLANTLINPQPITTFQQK PA
2
224-231 (8) ESIYLSNR PA
2
238-247 (10) SHDQAPGLPK PA
2
248-262 (15) GMDTTNTTFGTAVIK PA
2
282-303 (22) EGNEGHDLYVVSHNDYYAGEAK PA
2
307-314 (8) YNPSSFHR PA
2
315-329 (15) CSVYGVPTPHFNDGR PA
2
334-344 (11) SLYWLHELQMK PA
2
368-402 (35) VLDPIAETMNVPPDCTFGACLRPEEYGVGDLIHNR PA
2
433-441 (9) FDTLLAAFR PA
2
454-470 (17) DELQEACDQANLSLDDK PA
1
471-499 (29) LLDQLFDYCDVDNDGFINYLEFANFLNWK PA
1
517-545 (29) KPDCVNPTEANVEEPEQTLLIKPEDIVLK PA
1
556-563 (8) TLLRPSDK PA
1
570-596 (27) TTSSEINAIVGAIPSTCYPICGVPTIR PA
1
611-630 (20) TNYGEEGSAYSLLYPTIFAR PA
1
645-657 (13) EEIAEILCNIGVK PA
1
658-672 (15) LSDEEFENVWNLASK PA
1
677-685 (9) GEVCVENIR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center