Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N7X0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
14-22 (9) INSAHGSDK PA
0
25-41 (17) DFYPFGSNVQSGSTEQK PA
0
45-60 (16) FPLWPEWSEADINSEK PA
0
76-88 (13) SPVFHFFEDPEGK PA
0
89-96 (8) IELPPSLK PA
0
102-116 (15) RPQDILFSQTPVVVK PA
0
117-137 (21) NEITFDLFSANEHLLCSELMR PA
0
138-148 (11) WIISEIYAVWK PA
0
149-160 (12) IFNGGILSNYFK PA
0
161-182 (22) GTSGEPPLLPWKPWEHIYSLCK PA
0
186-196 (11) GHMPLFNSYGK PA
0
201-208 (8) LYWMGCWR PA
0
210-242 (33) ITIDDFLPFDEDNNLLLPATTYEFELWPMLLSK PA
0
247-257 (11) LANIDIHVADR PA
0
259-286 (28) ELGEFTVIHALTGWLPEVISLHPGYMDK PA
0
300-309 (10) LSDEASSESK PA
0
341-352 (12) EFKPESSLTTLK PA
0
385-430 (46) FSLHGSRPSSEVQYSVQSLSDCSSAIQTSHMVVYATFTPLYLFENK PA
0
446-461 (16) EYGLSHICSHPVLVTR PA
0
464-480 (17) SCPLVAPPKPPPLPPWK PA
0
487-500 (14) ETVITDEAQELIVK PA
0
505-516 (12) FLEISSPFLNYR PA
0
517-530 (14) MTPFTIPTEMHFVR PA
0
536-565 (30) GIPPGSDLPSVSETDETATHSQTDLSQITK PA
0
566-580 (15) ATSQGNTASQVILGK PA
0
581-603 (23) GTDEQTDFGLGDAHQSDGLNLER PA
0
604-615 (12) EIVSQTTATQEK PA
0
616-629 (14) SQEELPTTNNSVSK PA
0
630-660 (31) EIWLDFEDFCVCFQNIYIFHKPSSYCLNFQK PA
0
670-693 (24) VSYYLFVDSLKPIELLVCFSALVR PA
0
694-702 (9) WGEYGALTK PA
0
703-720 (18) DSPPIEPGLLTAETFSWK PA
0
721-730 (10) SLKPGSLVLK PA
0
748-788 (41) HMLLFNAYSPVGHSIHICSMVSFVIGDEHVVLPNFEPESCR PA
0
789-798 (10) FTEQSLLIMK PA
0
799-808 (10) AIGNVIANFK PA
0
819-832 (14) DLQTAHYPVPFHDK PA
0
833-840 (8) ELTAQHFR PA
0
841-848 (8) VFHLSLWR PA
0
853-863 (11) VQITKPPPNFK PA
0
868-892 (25) AMVLDLELLNSSLEEVSLVEWLDVK PA
0
893-900 (8) YCMPTSDK PA
0
901-912 (12) EYSAEEVAAAIK PA
0
935-945 (11) ENISVADTLQK PA
0
946-963 (18) VWAVLEMNLEQYAVSLLR PA
0
972-985 (14) SLESYPCYQDEETK PA
1
986-1008 (23) IAFADYTVTYQEQPPNSWFIVFR PA
1
1009-1022 (14) ETFLVHQDMILVPK PA
1
1023-1045 (23) VYTTLPICILHIVNNDTMEQVPK PA
1
1050-1057 (8) VVPYLYTK PA
1
1061-1079 (19) GYTFVAEAFTGDTYVAASR PA
1
1084-1096 (13) LIGSSAPLPCLSR PA
1
1097-1106 (10) DSPCNSFAIK PA
1
1110-1117 (8) DYYIPNDK PA
1
1127-1138 (12) VLTPQPATIQVR PA
1
1139-1147 (9) TSKPDAFIK PA
1
1148-1163 (16) LQVLENEETMVSSTGK PA
1
1164-1175 (12) GQAIIPAFHFLK PA
1
1179-1186 (8) GLSSQSSK PA
0
1187-1196 (10) HILSFHSASK PA
0
1219-1241 (23) AVSAIQDIGLPLVEEETTSTPTR PA
0
1242-1253 (12) EDSSSTPLQNYK PA
0
1254-1279 (26) YIIQCSVLYNSWPLTESQLTFVQALK PA
0
1293-1312 (20) HEELINLGSPDSHTISEGQK PA
1
1342-1364 (23) FEPQISTVHPQQEDPNKPYWILR PA
1
1365-1378 (14) LVTEHNESELFEVK PA
1
1392-1401 (10) QAWETTEPGR PA
1
1410-1418 (9) LHYLSGFIK PA
1
1420-1436 (17) TSDAESPPISESQTKPK PA
1
1437-1444 (8) EEVETAAR PA
1
1453-1460 (8) NSAGSESK PA
1
1461-1473 (13) EMTQTGSGSAVWK PA
1
1487-1500 (14) STSSESGGVSSPGK PA
1
1510-1517 (8) ENIQTGPR PA
1
1520-1529 (10) SPTILETSPR PA
1
1534-1545 (12) ALEFMDLSQYVR PA
1
1547-1566 (20) TDTDPLLQTDELNQQQAMQK PA
1
1567-1574 (8) AEEIHQFR PA
1
1596-1603 (8) DEVLDMYK PA
1
1604-1613 (10) EMQDSLDEAR PA
1
1627-1634 (8) LLEAEHLK PA
1
1635-1646 (12) LETLAAQEAAMK PA
1
1652-1660 (9) MTPAPDTQK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center