Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N813-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MGTGASEK PA
0
17-106 (90) AFEASEEAHGTLAASTPWVAMGSAYGSCTCLGAQPVTDLALWPVIYSCMGFSPQAYPAFWAYPWVLYGGYLWMGYPPPAALVPSVWLYWR PA
0
107-133 (27) GASSFDPLIGSPYLAALAPNLFPFPMK PA
0
134-167 (34) FPPTYSLASPTLGGATSSHCPQVGCWTPASSAPR PA
0
168-175 (8) AAVEGPSR PA
0
185-193 (9) APPSEWASR PA
0
194-226 (33) FGIWAPLPCCSSELRPLPPSPIEDSQLDPGCSR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center