Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N8J6-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-30 (30) MMQAQESLTLEDVAVDFTWEEWQFLSPAQK PA
1
35-59 (25) DVMLENYSNLVAVGYQASKPDALSK PA
2
63-76 (14) GEETCTTEDEIYSR PA
2
77-93 (17) ICSDSGGASGGAYAEIR PA
1
95-110 (16) IDDPLQHHLQNQSIQK PA
2
114-129 (16) QCHEQNMFGNIVNQNK PA
2
136-149 (14) QDCDTFDLHEKPLK PA
2
150-158 (9) SNLSFENQK PA
2
175-182 (8) SLFHANHK PA
2
190-199 (10) FPAIAKPINK PA
2
208-222 (15) THNIENAHVCSECGK PA
2
227-235 (9) LSQFIDHQR PA
2
236-250 (15) VHTGEKPHVCSMCGK PA
2
270-278 (9) HYECTECDK PA
2
284-291 (8) SQLNIHQK PA
2
292-306 (15) THMGGKPYTCSQCGK PA
2
320-334 (15) THTGEKPHGCSVCGK PA
2
340-347 (8) FSLTTHQK PA
2
348-362 (15) THTGEKPYICSECGK PA
7
376-387 (12) THTGEKPFICNK PA
2
396-409 (14) NSLITHQQTHTGEK PA
2
410-418 (9) LYTCSECGK PA
2
424-431 (8) HCLMVHQR PA
2
432-440 (9) THTGEKPYK PA
107
460-473 (14) THTGEKPYVCTECR PA
2
480-487 (8) SDLIVHQR PA
3
488-502 (15) THTAEKPYICNDCGK PA
2
516-530 (15) THTGEKPYVCGECGK PA
2
544-558 (15) THTGEKPYICNECGK PA
11
572-586 (15) THTGEKPYVCSECGK PA
2
592-599 (8) SMLIAHQR PA
2
600-614 (15) THTGEKPYICNECGK PA
11
620-636 (17) STLSIHQQTHTGEKPYK PA
2
648-655 (8) TCLIQHQR PA
3
661-670 (10) TSFACTECGK PA
2
676-683 (8) NDLITHQR PA
2
684-692 (9) IHTGEKPYK PA
242
704-711 (8) SGLNVHQR PA
2
713-726 (14) HTGERPYGCSDCGK PA
2
727-736 (10) AFAHLSILVK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center