Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N8M0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-19 (17) LEASCGTATSEVPKPEK PA
1
24-41 (18) DAEPSSETRPQEVEAEPR PA
1
42-61 (20) SGSGPEAEAEPLDFVVATER PA
1
62-83 (22) EFEEVLAISGGIYGGLDYLPSR PA
1
101-125 (25) NGGVIALESVNVIDAGETVLVEGLR PA
0
134-141 (8) GVAGLLQR PA
0
186-198 (13) FNASALLAGLGAR PA
0
204-225 (22) TSGTFSPLPTEAVSEAGGDVAR PA
0
226-234 (9) LLLSPSVQR PA
0
235-257 (23) DVLPGGTIIQDWQPYRPSESNLR PA
0
276-295 (20) VLTLCTRPFPIPHGGDGTWR PA
0
296-319 (24) YLNIDAFGSDGAQVQSQLLWHLQR PA
0
324-357 (34) LVGLNVMCQLFLEPQLWSQLADFCQVGLGLELVK PA
0
358-369 (12) GYTEQYLLEADI PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center