Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N8Z8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-26 (26) MDSVAFEDVAINFTCEEWALLGPSQK PA
0
31-38 (8) DVMQETIR PA
3
39-58 (20) NLDCIGMIWQNHDIEEDQYK PA
0
77-96 (20) DNSQCGGPFTQTQDSIVNEK PA
1
97-115 (19) IPGVDPWESSECTDVLMGR PA
1
116-123 (8) SSLNCYVR PA
1
124-166 (43) VDSEHKPCEYQEYGEKPYTHTQCGTAFSYQPCFQIHERPQHGK PA
1
173-185 (13) ECASFSSLENLQR PA
1
186-196 (11) HMAAHHGDGPR PA
1
200-215 (16) LCGNAFIWPSLFHMLR PA
1
217-241 (25) THTEEKPYEYEQCSTAFPAYSSTLR PA
1
245-255 (11) THSGEKPYQCK PA
1
260-272 (13) AFSCSCYTQLYER PA
1
273-283 (11) THTGEQSYECK PA
1
288-297 (10) AFYHLGSFQR PA
1
298-309 (12) HMIVHTGDGPHK PA
1
316-324 (9) GFLSPSSVR PA
1
329-339 (11) THTGEKPYECK PA
68
344-352 (9) AFSDCTGFR PA
1
354-365 (12) HMITHTGDGPHK PA
1
372-380 (9) AFDSPSLCR PA
1
382-393 (12) HETTHTGEKPYK PA
6
399-407 (9) AFSDFYYFR PA
1
408-420 (13) NHETTHTGEKPYK PA
1
427-439 (13) AFICCTYLQIHER PA
1
440-448 (9) IHTGERPYK PA
46
468-478 (11) THTGEKPYECK PA
68
493-504 (12) HMIMHTGDGPHK PA
1
511-519 (9) SFDSPSSFR PA
1
524-532 (9) IHTGERPYK PA
46
542-551 (10) SSSYIQLHER PA
1
552-566 (15) THTGEKPYGCQQCGK PA
1
567-575 (9) ALSDLSSFR PA
1
577-588 (12) HMITHTGNGPHK PA
1
595-604 (10) GFDYPSSVQR PA
1
608-618 (11) THTGEKPYECK PA
68
623-631 (9) AFSHSSYLR PA
1
636-644 (9) VHTGEKPYK PA
80
647-660 (14) ECGKPFHCPSAFHK PA
1
664-672 (9) THSMEKPYK PA
1
675-688 (14) ECGEAFHCISSFHK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center