Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N8Z8-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-14 (14) MIWQNHDIEEDQYK PA
0
33-52 (20) DNSQCGGPFTQTQDSIVNEK PA
1
53-71 (19) IPGVDPWESSECTDVLMGR PA
1
72-79 (8) SSLNCYVR PA
1
80-122 (43) VDSEHKPCEYQEYGEKPYTHTQCGTAFSYQPCFQIHERPQHGK PA
1
129-141 (13) ECASFSSLENLQR PA
1
142-152 (11) HMAAHHGDGPR PA
1
156-171 (16) LCGNAFIWPSLFHMLR PA
1
173-197 (25) THTEEKPYEYEQCSTAFPAYSSTLR PA
1
201-211 (11) THSGEKPYQCK PA
1
216-228 (13) AFSCSCYTQLYER PA
1
229-239 (11) THTGEQSYECK PA
1
244-253 (10) AFYHLGSFQR PA
1
254-265 (12) HMIVHTGDGPHK PA
1
272-280 (9) GFLSPSSVR PA
1
285-295 (11) THTGEKPYECK PA
68
300-308 (9) AFSDCTGFR PA
1
310-321 (12) HMITHTGDGPHK PA
1
328-336 (9) AFDSPSLCR PA
1
338-349 (12) HETTHTGEKPYK PA
6
355-363 (9) AFSDFYYFR PA
1
364-376 (13) NHETTHTGEKPYK PA
1
383-395 (13) AFICCTYLQIHER PA
1
396-404 (9) IHTGERPYK PA
46
424-434 (11) THTGEKPYECK PA
68
449-460 (12) HMIMHTGDGPHK PA
1
467-475 (9) SFDSPSSFR PA
1
480-488 (9) IHTGERPYK PA
46
498-507 (10) SSSYIQLHER PA
1
508-522 (15) THTGEKPYGCQQCGK PA
1
523-531 (9) ALSDLSSFR PA
1
533-544 (12) HMITHTGNGPHK PA
1
551-560 (10) GFDYPSSVQR PA
1
564-574 (11) THTGEKPYECK PA
68
579-587 (9) AFSHSSYLR PA
1
592-600 (9) VHTGEKPYK PA
80
603-616 (14) ECGKPFHCPSAFHK PA
1
620-628 (9) THSMEKPYK PA
1
631-644 (14) ECGEAFHCISSFHK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center