Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8N9V7-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-20 (18) RPPPLGPTTASGPEGNVR PA
0
26-44 (19) QAPGPGAAGGCGPEAGGCR PA
0
68-76 (9) SVAASGAGK PA
0
87-98 (12) GPVSPSDSSDPR PA
0
105-114 (10) EAELPLQTER PA
0
122-138 (17) VTEASSDDPQPGLDLVR PA
0
140-159 (20) ESLTSSESFQTVECLQSLGK PA
0
160-167 (8) ESIIEGIK PA
0
177-184 (8) SLENPPLK PA
0
185-195 (11) ITENEATQNIK PA
0
196-204 (9) VEFQDELYK PA
0
209-225 (17) YSCNILSPEVENNSVLK PA
0
228-236 (9) DCNCFPHSK PA
0
237-261 (25) GCNDENNLPYKPDGGCMHVAENFSK PA
0
272-292 (21) SDTNSIPQLLQTEENVMGVNK PA
0
293-304 (12) LLPEESDLYQSK PA
0
305-316 (12) TNGLLSCLQHEK PA
0
319-328 (10) YSIEESSVGR PA
0
340-355 (16) ADETVTEMNFSNEYNK PA
0
356-370 (15) SELMLQENQMIADGK PA
0
384-404 (21) VSHNTVSLMDHLLSVPETVEK PA
0
405-418 (14) ETSSEHHVNAVFQK PA
0
426-443 (18) EETENASEPLGYESMASK PA
0
456-464 (9) SPNEYHIER PA
0
493-501 (9) TWPYYSCAR PA
0
510-520 (11) ASLPESSYFLR PA
0
534-545 (12) HQTNQTHLTDSK PA
0
546-562 (17) LLLQSSLTETNTESSSK PA
0
565-586 (22) LDSNSNCLSSVSAVEPTLMVIK PA
0
605-629 (25) GSEVISNTTEDTQLTSETQSLTGNK PA
0
639-646 (8) LNLTATSK PA
0
647-657 (11) DGQEANNSAGK PA
0
663-677 (15) ACIAQQTFIVPDLVK PA
0
710-727 (18) EAYSPLELLDNLSGADVR PA
0
733-748 (16) ENVSMMMLGPQTLSIR PA
0
749-764 (16) NSVTPVQASSDSFYNK PA
0
766-775 (10) SYSISPSFTK PA
0
776-796 (21) QGNNSKPSNHVSEPGNIVSNK PA
0
797-817 (21) EVASLTVENNAFSCDPGYVEK PA
0
818-837 (20) SPSFCCNEQETFRPVSSEVR PA
0
844-855 (12) NFSEVGFPDILK PA
0
856-890 (35) AYEDDVLLIDVIQDDPDLFGVSNEGELSFTSEVPK PA
0
891-907 (17) ISQEPNVAGEHQSTDSK PA
0
923-947 (25) ELPVLDCGWIKPDICASNSAESEIK PA
0
952-978 (27) DVNTSLGEVANETSENETLGDFSEQIK PA
0
999-1006 (8) ENIYEVCK PA
0
1012-1042 (31) NADFMVGECQFAVPVPKPLCLLVPPLNLSGR PA
0
1043-1056 (14) QEDTILNTWMNDFR PA
0
1066-1076 (11) LQNPETCEIFK PA
0
1087-1095 (9) SLGLMIPYK PA
0
1106-1113 (8) GCERPLCK PA
0
1114-1124 (11) FAHVPEQGDEK PA
0
1133-1144 (12) YININELCLLQR PA
0
1145-1154 (10) AVNIFMEYYR PA
0
1156-1176 (21) FPPGVYFDLQVLNDLLNSLLK PA
0
1182-1194 (13) EVFQIVNLSIMVK PA
0
1201-1213 (13) ILLNIFEYVATMK PA
0
1216-1227 (12) NAVPALIDIFCK PA
0
1228-1245 (18) LVEAGMVLDPEHFNYIVK PA
0
1246-1254 (9) LLYQVQASK PA
0
1255-1264 (10) QEITAVLEMK PA
0
1278-1286 (9) CDLDSALNK PA
0
1313-1329 (17) FADFQTFCACIAETLTK PA
0
1330-1349 (20) NYEDERPDIPFCEFAETVSK PA
0
1364-1374 (11) IGISAMYFYHK PA
0
1411-1423 (13) CQIVNVAAEIFLK PA
0
1424-1435 (12) SGSLDGAIWVMR PA
0
1436-1450 (15) ESEWIINTPLWPCDR PA
0
1457-1470 (14) HNLLCTIAHEILAK PA
0
1475-1504 (30) QTFEVLQNLPGFQNSQETVEVSQYSLLFNK PA
0
1505-1528 (24) LLGSCIESSSLGMSSSVAEFMISK PA
0
1529-1538 (10) SIPIDFSFLR PA
0
1559-1575 (17) SALSLGCYPPLEGNLYR PA
0
1577-1619 (43) LLLIPSYLSEIEMLLAIEIFMVSNASSIQSPGTSTQILQIVLK PA
0
1628-1638 (11) SNDDYQAAVER PA
0
1654-1661 (8) HMTVNVNK PA
0
1662-1674 (13) EQVYSLEHCSALK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center