Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NA61-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MSPLECSECFGDQLLHR PA
0
18-33 (16) TYTWQLTLHSRPNYTR PA
0
39-53 (15) SESLEIPISVVLPQR PA
0
54-61 (8) GTAEPFPR PA
1
62-70 (9) LHNLYSTPR PA
1
71-79 (9) CAQQAALPR PA
1
84-94 (11) MASQHSYPLNR PA
1
95-120 (26) FSSVPLDPMERPMSQADLELDYNPPR PA
1
121-134 (14) VQLSDEMFVFQDGR PA
1
142-156 (15) LQSPYFSPSASFHHK PA
1
165-173 (9) ECMLQEENK PA
1
195-204 (10) ILQVFWEEHK PA
1
214-221 (8) APSPLLHK PA
1
222-230 (9) DSASLEVVK PA
1
232-240 (9) DHVALQVPR PA
1
243-251 (9) EDSTLQLLR PA
1
256-264 (9) ALQQLLEQK PA
1
265-307 (43) QAYWAQAEDTAAPAEESKPAPSPHEEPCSPGLLQDQGSGLSSR PA
1
330-344 (15) MVSNMSGPSGEEEAK PA
1
345-360 (16) VGPGLPDGCQPLQLLR PA
1
364-371 (8) QALQALLK PA
1
412-423 (12) LVIDTVTEVTAR PA
1
424-438 (15) MEMLIEELYAFMPAR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center