Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NA61-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-17 (8) MEESNAER PA
0
18-25 (8) GTAEPFPR PA
1
26-34 (9) LHNLYSTPR PA
1
35-43 (9) CAQQAALPR PA
1
48-58 (11) MASQHSYPLNR PA
1
59-84 (26) FSSVPLDPMERPMSQADLELDYNPPR PA
1
85-98 (14) VQLSDEMFVFQDGR PA
1
106-120 (15) LQSPYFSPSASFHHK PA
1
129-137 (9) ECMLQEENK PA
1
159-168 (10) ILQVFWEEHK PA
1
178-185 (8) APSPLLHK PA
1
186-194 (9) DSASLEVVK PA
1
196-204 (9) DHVALQVPR PA
1
207-215 (9) EDSTLQLLR PA
1
220-228 (9) ALQQLLEQK PA
1
229-271 (43) QAYWAQAEDTAAPAEESKPAPSPHEEPCSPGLLQDQGSGLSSR PA
1
294-308 (15) MVSNMSGPSGEEEAK PA
1
309-324 (16) VGPGLPDGCQPLQLLR PA
1
328-335 (8) QALQALLK PA
1
376-387 (12) LVIDTVTEVTAR PA
1
388-402 (15) MEMLIEELYAFMPAR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center