Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NB12-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-17 (12) MENVEVFTAEGK PA
0
26-37 (12) EFWAADIIFAER PA
0
38-57 (20) AYSAVVFDSLVNFVCHTCFK PA
0
117-145 (29) EGTGLTEGCLVSVDDLQNHVEHFGEEEQK PA
0
149-188 (40) VDVDTFLQYWPPQSQQFSMQYISHIFGVINCNGFTLSDQR PA
0
189-225 (37) GLQAVGVGIFPNLGLVNHDCWPNCTVIFNNGNHEAVK PA
0
226-233 (8) SMFHTQMR PA
0
242-262 (21) ISEGEELTVSYIDFLNVSEER PA
0
269-281 (13) QYYFDCTCEHCQK PA
0
285-292 (8) DDLFLGVK PA
0
293-303 (11) DNPKPSQEVVK PA
0
321-330 (10) SEGLYHEVVK PA
0
339-352 (14) QEPVFADTNIYMLR PA
0
353-375 (23) MLSIVSEVLSYLQAFEEASFYAR PA
0
384-398 (15) LYHPNNAQLGMAVMR PA
0
399-418 (20) AGLTNWHAGNIEVGHGMICK PA
0
419-435 (17) AYAILLVTHGPSHPITK PA
0
442-449 (8) VQTEMELR PA
0
453-460 (8) QNEFMYYK PA
0
463-488 (26) EAALNNQPMQVMAEPSNEPSPALFHK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center