Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NB90-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-31 (22) LNQSAENGSSLPSAASSCAEAR PA
2
32-54 (23) APSAGSDFAATSGTLTVTNLLEK PA
2
62-76 (15) TFQNSLIHLGLNTMK PA
2
77-94 (18) SANICIGRPVLLTSLNGK PA
2
95-110 (16) QEVYTAWPMAGFPGGK PA
2
111-119 (9) VGLSEMAQK PA
2
120-151 (32) NVGVRPGDAIQVQPLVGAVLQAEEMDVALSDK PA
2
152-166 (15) DMEINEEELTGCILR PA
2
172-189 (18) IVLPGNFLYCTFYGRPYK PA
2
197-216 (20) GADGMILGGPQSDSDTDAQR PA
2
217-249 (33) MAFEQSSMETSSLELSLQLSQLDLEDTQIPTSR PA
2
250-259 (10) STPYKPIDDR PA
2
264-290 (27) ASDVLLDVTQSPGDGSGLMLEEVTGLK PA
2
298-308 (11) EGNEQLTEEER PA
2
318-331 (14) CNTDTFYFISSTTR PA
2
332-339 (8) VNFTEIDK PA
2
350-363 (14) VTYDMIGGLSSQLK PA
2
367-374 (8) EIIELPLK PA
2
381-388 (8) SYGIPAPR PA
2
389-400 (12) GVLLYGPPGTGK PA
4
406-426 (21) AVANEVGAYVSVINGPEIISK PA
2
427-434 (8) FYGETEAK PA
2
437-445 (9) QIFAEATLR PA
2
446-461 (16) HPSIIFIDELDALCPK PA
2
463-471 (9) EGAQNEVEK PA
2
473-510 (38) VVASLLTLMDGIGSEVSEGQVLVLGATNRPHALDAALR PA
2
518-529 (12) EIEIGVPNAQDR PA
2
540-565 (26) VPHLLTEAELLQLANSAHGYVGADLK PA
2
566-577 (12) VLCNEAGLCALR PA
2
583-590 (8) QPNLPDVK PA
2
601-615 (15) DFLQAMNDIRPSAMR PA
2
616-636 (21) EIAIDVPNVSWSDIGGLESIK PA
2
639-648 (10) LEQAVEWPLK PA
2
663-674 (12) GVLLYGPPGCSK PA
2
680-693 (14) ALANESGLNFLAIK PA
2
718-736 (19) AVAPSIIFFDELDALAVER PA
1
737-748 (12) GSSLGAGNVADR PA
1
749-764 (16) VLAQLLTEMDGIEQLK PA
1
765-777 (13) DVTILAATNRPDR PA
1
791-802 (12) IIYVPLPDAATR PA
0
808-841 (34) LQFHSMPVSNEVDLDELILQTDAYSGAEIVAVCR PA
0
842-859 (18) EAALLALEEDIQANLIMK PA
0
861-872 (12) HFTQALSTVTPR PA
0
880-887 (8) FYEDYQEK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center