Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NBD8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-12 (12) MASAEPLTALSR PA
0
13-40 (28) WYLYAIHGYFCEVMFTAAWEFVVNLNWK PA
0
41-62 (22) FPGVTSVWALFIYGTSILIVER PA
0
77-96 (20) CLIYTLWTYLWEFTTGFILR PA
0
97-137 (41) QFNACPWDYSQFDFDFMGLITLEYAVPWFCGALIMEQFIIR PA
0
147-165 (19) DAEPGEPSGALALANGHVK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center