Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NCP5-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-20 (16) TFTHSSSSHSQEMLGK PA
3
26-36 (11) NDGHFCDITIR PA
3
47-57 (11) VVLAACSDFFR PA
3
60-69 (10) LVGQAEDENK PA
3
70-125 (56) NVLDLHHVTVTGFIPLLEYAYTATLSINTENIIDVLAAASYMQMFSVASTCSEFMK PA
3
126-139 (14) SSILWNTPNSQPEK PA
3
140-156 (17) GLDAGQENNSNCNFTSR PA
3
157-172 (16) DGSISPVSSECSVVER PA
3
186-197 (12) SYIVMSPESPVK PA
3
198-218 (21) CGTQTSSPQVLNSSASYSENR PA
3
219-238 (20) NQPVDSSLAFPWTFPFGIDR PA
3
253-264 (12) TLELPGPSETGR PA
3
266-276 (11) MADYVTCESTK PA
3
277-288 (12) TTLPLGTEEDVR PA
3
294-368 (75) LSDEEVHEEVSQPVSASQSSLSDQQTVPGSEQVQEDLLISPQSSSIGSVDEGVSEGLPTLQSTSSTNAPPDDDDR PA
3
369-407 (39) LENVQYPYQLYIAPSTSSTERPSPNGPDRPFQCPTCGVR PA
3
416-431 (16) QHMLIHSGIKPFQCDR PA
3
457-471 (15) CQICSATFTSFGEYK PA
0
491-507 (17) TCGAMLTNSGNLIVHLR PA
0
508-566 (59) SLNHEASELANYFQSSDFLVPDYLNQEQEETLVQYDLGEHGFESNSSVQMPVISQYHSK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center