Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NDV7-6)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
19-31 (13) DLVQEEEQLMEEK PA
1
55-86 (32) VPEQIKPSVSQPQPANSNNGTSTATSTNNNAK PA
1
88-131 (44) ATANNQQPQQQQQQQQPQQQQPQQQPQPQPQQQQPQQQPQALPR PA
2
152-167 (16) GQHFPVIAANLGSAVK PA
2
168-193 (26) VLNSQSESSALTNQQPQNNGEVQNSK PA
2
194-212 (19) NQSDINHSTSGSHYENSQR PA
2
213-226 (14) GPVSSTSDSSTNCK PA
2
227-236 (10) NAVVSDLSEK PA
2
237-266 (30) EAWPSAPGSDPELASECMDADSASSSESER PA
2
267-280 (14) NITIMASGNTGGEK PA
3
285-294 (10) NSTGLGSQNK PA
3
295-334 (40) FVVGSSSNNVGHGSSTGPWGFSHGAIISTCQVSVDAPESK PA
3
342-381 (40) MNAWGTVSSSSNGGLNPSTLNSASNHGAWPVLENNGLALK PA
3
382-410 (29) GPVGSGSSGINIQCSTIGQMPNNQSINSK PA
3
411-436 (26) VSGGSTHGTWGSLQETCESEVSGTQK PA
3
437-484 (48) VSFSGQPQNITTEMTGPNNTTNFMTSSLPNSGSVQNNELPSSNTGAWR PA
3
485-513 (29) VSTMNHPQMQAPSGMNGTSLSHLSNGESK PA
3
514-533 (20) SGGSYGTTWGAYGSNYSGDK PA
3
534-569 (36) CSGPNGQANGDTVNATLMQPGVNGPMGTNFQVNTNK PA
3
570-598 (29) GGGVWESGAANSQSTSWGSGNGANSGGSR PA
3
600-619 (20) GWGTPAQNTGTNLPSVEWNK PA
3
620-635 (16) LPSNQHSNDSANGNGK PA
3
643-665 (23) STEEEDQGSATSQTNEQSSVWAK PA
3
666-681 (16) TGGTVESDGSTESTGR PA
3
686-693 (8) GTGESQSR PA
3
698-710 (13) IDQHTLLQSIVNR PA
3
717-729 (13) VLSNSGWGQTPIK PA
3
730-741 (12) QNTAWDTETSPR PA
3
746-769 (24) TDNGTEAWGSSATQTFNSGACIDK PA
3
770-791 (22) TSPNGNDTSSVSGWGDPKPALR PA
3
797-815 (19) GSNCQGGWEDDSAATGMVK PA
3
816-823 (8) SNQWGNCK PA
3
827-834 (8) AAWNDSQK PA
3
837-844 (8) QGWGDGQK PA
3
845-862 (18) SSQGWSVSASDNWGETSR PA
3
863-871 (9) NNHWGEANK PA
3
873-882 (10) SSSGGSDSDR PA
3
883-892 (10) SVSGWNELGK PA
3
893-927 (35) TSSFTWGNNINPNNSSGWDESSKPTPSQGWGDPPK PA
3
928-948 (21) SNQSLGWGDSSKPVSSPDWNK PA
3
949-980 (32) QQDIVGSWGIPPATGKPPGTGWLGGPIPAPAK PA
3
981-996 (16) EEEPTGWEEPSPESIR PA
3
999-1013 (15) MEIDDGTSAWGDPSK PA
3
1025-1032 (8) NVPNGNSR PA
3
1033-1052 (20) SDQQAQVHQLLTPASAISNK PA
3
1053-1116 (64) EASSGSGWGEPWGEPSTPATTVDNGTSAWGKPIDSGPSWGEPIAAASSTSTWGSSSVGPQALSK PA
3
1121-1171 (51) SMQDGWCGDDMPLPGNRPTGWEEEEDVEIGMWNSNSSQELNSSLNWPPYTK PA
3
1196-1206 (11) QEEAWINPFVK PA
3
1207-1215 (9) QFSNISFSR PA
3
1216-1226 (11) DSPEENVQSNK PA
3
1227-1237 (11) MDLSGGMLQDK PA
3
1244-1253 (10) HSLNIGDYNR PA
4
1258-1267 (10) GPGSRPQISK PA
4
1280-1296 (17) NGNPSMFGVGNTAAQPR PA
1
1297-1314 (18) GMQQPPAQPLSSSQPNLR PA
4
1315-1332 (18) AQVPPPLLSPQVPVSLLK PA
4
1333-1369 (37) YAPNNGGLNPLFGPQQVAMLNQLSQLNQLSQISQLQR PA
4
1382-1409 (28) SVPSGNRPQQDQQGRPLSVQQQMMQQSR PA
4
1410-1418 (9) QLDPNLLVK PA
4
1419-1435 (17) QQTPPSQQQPLHQPAMK PA
4
1436-1451 (16) SFLDNVMPHTTPELQK PA
4
1452-1480 (29) GPSPINAFSNFPIGLNSNLNVNMDMNSIK PA
4
1489-1507 (19) WTTVDSISVNTSLDQNSSK PA
4
1508-1516 (9) HGAISSGFR PA
4
1517-1547 (31) LEESPFVPYDFMNSSTSPASPPGSIGDGWPR PA
4
1550-1570 (21) SPNGSSSVNWPPEFRPGEPWK PA
3
1571-1598 (28) GYPNIDPETDPYVTPGSVINNLSINTVR PA
3
1607-1628 (22) NSGSSSSLNTTLPSTSAWSSIR PA
3
1629-1646 (18) ASNYNVPLSSTAQSTSAR PA
3
1652-1670 (19) LTWSPGSVTNTSLAHELWK PA
3
1677-1704 (28) NITAPSRPPPGLTGQKPPLSTWDNSPLR PA
3
1705-1715 (11) IGGGWGNSDAR PA
3
1716-1729 (14) YTPGSSWGESSSGR PA
3
1730-1737 (8) ITNWLVLK PA
3
1738-1749 (12) NLTPQIDGSTLR PA
5
1750-1773 (24) TLCMQHGPLITFHLNLPHGNALVR PA
3
1786-1809 (24) SLHMCVLGNTTILAEFASEEEISR PA
4
1810-1832 (23) FFAQSQSLTPSPGWQSLGSSQSR PA
4
1833-1845 (13) LGSLDCSHSFSSR PA
4
1846-1889 (44) TDLNHWNGAGLSGTNCGDLHGTSLWGTPHYSTSLWGPPSSSDPR PA
4
1890-1913 (24) GISSPSPINAFLSVDHLGGGGESM PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center