Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NDY6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-32 (27) SLSGDAYLALSHGYAAAAAGLAYGAAR PA
0
39-56 (18) GYGTPGPGGDLPAAPAPR PA
0
57-79 (23) APAQAAESSGEQSGDEDDAFEQR PA
0
84-92 (9) GPGSAADGR PA
0
113-124 (12) MHDLNDALDGLR PA
0
125-136 (12) AVIPYAHSPSVR PA
1
141-148 (8) IATLLLAK PA
1
149-162 (14) NYILMQAQALDEMR PA
0
164-206 (43) LVAFLNQGQGLAAPVNAAPLTPFGQATVCPFSAGAALGPCPDK PA
0
207-219 (13) CAAFSGTPSALCK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center