Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NEE6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MTPELMIK PA
3
9-19 (11) ACSFYTGHLVK PA
3
31-40 (10) TNENVVLAEK PA
3
44-51 (8) AVTCYNFR PA
3
55-68 (14) SVFHHWHSYMEDQK PA
3
78-86 (9) IQQIIYCHK PA
3
129-139 (11) AAAEESNFPER PA
3
140-152 (13) SSSEVFLVDETLK PA
3
153-161 (9) CDISLLPER PA
3
162-173 (12) AILQIFFYLSLK PA
3
174-204 (31) DVIICGQVNHAWMLMTQLNSLWNAIDFSSVK PA
3
211-218 (8) YIVSTLQR PA
3
246-264 (19) NLQELNVSDCPTFTDESMR PA
3
265-286 (22) HISEGCPGVLCLNLSNTTITNR PA
3
294-307 (14) HFHNLQNLSLAYCR PA
3
313-325 (13) GLQYLNLGNGCHK PA
3
326-343 (18) LIYLDLSGCTQISVQGFR PA
2
344-369 (26) YIANSCTGIMHLTINDMPTLTDNCVK PA
2
378-395 (18) ITSLVFTGAPHISDCTFR PA
2
424-437 (14) NYPNLSHIYMADCK PA
2
438-445 (8) GITDSSLR PA
2
452-463 (12) QLTVLNLANCVR PA
2
471-480 (10) QFLDGPASMR PA
2
483-491 (9) ELNLSNCVR PA
2
492-499 (8) LSDASVMK PA
2
504-513 (10) CPNLNYLSLR PA
2
514-552 (39) NCEHLTAQGIGYIVNIFSLVSIDLSGTDISNEGLNVLSR PA
1
558-566 (9) ELSVSECYR PA
1
567-577 (11) ITDDGIQAFCK PA
0
578-599 (22) SSLILEHLDVSYCSQLSDMIIK PA
1
600-618 (19) ALAIYCINLTSLSIAGCPK PA
1
619-630 (12) ITDSAMEMLSAK PA
1
631-658 (28) CHYLHILDISGCVLLTDQILEDLQIGCK PA
3
665-673 (9) MQYCTNISK PA
3
683-695 (13) VQQQEYNTNDPPR PA
3
702-716 (15) EGNPVTELDNITSSK PA
3
717-724 (8) GALELTVK PA
3
726-735 (10) STYSSEDQAA PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center