Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NEE6-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MTPELMIK PA
3
9-19 (11) ACSFYTGHLVK PA
3
31-40 (10) TNENVVLAEK PA
3
44-51 (8) AVTCYNFR PA
3
55-68 (14) SVFHHWHSYMEDQK PA
3
78-86 (9) IQQIIYCHK PA
3
129-139 (11) AAAEESNFPER PA
3
140-152 (13) SSSEVFLVDETLK PA
3
153-161 (9) CDISLLPER PA
3
162-173 (12) AILQIFFYLSLK PA
3
174-204 (31) DVIICGQVNHAWMLMTQLNSLWNAIDFSSVK PA
3
211-218 (8) YIVSTLQR PA
3
246-264 (19) NLQELNVSDCPTFTDESMR PA
3
265-286 (22) HISEGCPGVLCLNLSNTTITNR PA
3
294-307 (14) HFHNLQNLSLAYCR PA
3
313-325 (13) GLQYLNLGNGCHK PA
3
326-343 (18) LIYLDLSGCTQISVQGFR PA
2
344-369 (26) YIANSCTGIMHLTINDMPTLTDNCVK PA
2
378-395 (18) ITSLVFTGAPHISDCTFR PA
2
424-437 (14) NYPNLSHIYMADCK PA
2
438-445 (8) GITDSSLR PA
2
452-463 (12) QLTVLNLANCVR PA
2
471-480 (10) QFLDGPASMR PA
2
483-491 (9) ELNLSNCVR PA
2
492-499 (8) LSDASVMK PA
2
504-513 (10) CPNLNYLSLR PA
2
514-549 (36) NCEHLTAQGIGYIVNIFSLVSIDLSGTDISNEAFCK PA
0
550-571 (22) SSLILEHLDVSYCSQLSDMIIK PA
1
572-590 (19) ALAIYCINLTSLSIAGCPK PA
1
591-602 (12) ITDSAMEMLSAK PA
1
603-630 (28) CHYLHILDISGCVLLTDQILEDLQIGCK PA
3
637-645 (9) MQYCTNISK PA
3
655-667 (13) VQQQEYNTNDPPR PA
3
674-688 (15) EGNPVTELDNITSSK PA
3
689-696 (8) GALELTVK PA
3
698-707 (10) STYSSEDQAA PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center