Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NEE6-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MTPELMIK PA
3
9-19 (11) ACSFYTGHLVK PA
3
31-40 (10) TNENVVLAEK PA
3
44-51 (8) AVTCYNFR PA
3
55-68 (14) SVFHHWHSYMEDQK PA
3
78-86 (9) IQQIIYCHK PA
3
129-139 (11) AAAEESNFPER PA
3
140-152 (13) SSSEVFLVDETLK PA
3
153-161 (9) CDISLLPER PA
3
162-173 (12) AILQIFFYLSLK PA
3
174-204 (31) DVIICGQVNHAWMLMTQLNSLWNAIDFSSVK PA
3
211-218 (8) YIVSTLQR PA
3
246-264 (19) NLQELNVSDCPTFTDESMR PA
3
265-286 (22) HISEGCPGVLCLNLSNTTITNR PA
3
294-307 (14) HFHNLQNLSLAYCR PA
3
313-325 (13) GLQYLNLGNGCHK PA
3
326-348 (23) LIYLDLSGCTQITDSAMEMLSAK PA
0
349-376 (28) CHYLHILDISGCVLLTDQILEDLQIGCK PA
3
383-391 (9) MQYCTNISK PA
3
401-413 (13) VQQQEYNTNDPPR PA
3
420-434 (15) EGNPVTELDNITSSK PA
3
435-442 (8) GALELTVK PA
3
444-453 (10) STYSSEDQAA PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center