Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NEM2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-20 (20) MADGSLTGGGLEAAAMAPER PA
0
21-34 (14) MGWAVEQELASLEK PA
0
35-49 (15) GLFQDEDSCSDCSYR PA
0
50-64 (15) DKPGSSLQSFMPEGK PA
0
65-81 (17) TFFPEIFQTNQLLFYER PA
0
84-94 (11) AYQDYILADCK PA
0
95-108 (14) ASEVQEFTAEFLEK PA
0
109-116 (8) VLEPSGWR PA
0
117-125 (9) AVWHTNVFK PA
0
126-139 (14) VLVEITDVDFAALK PA
0
144-163 (20) LAEPYLCDSQVSTFTMECMK PA
0
173-199 (27) LPLQELWVVFDDSGVFDQTALAIEHVR PA
0
200-207 (8) FFYQNIWR PA
0
208-222 (15) SWDEEEEDEYDYFVR PA
0
230-238 (9) LHYDILEDR PA
0
239-259 (21) VPSGLIVDYHNLLSQCEESYR PA
0
266-287 (22) SSLSNCNSDSEQENISMVEGLK PA
0
288-296 (9) LYSEMEQLK PA
0
301-308 (8) LIENPLLR PA
0
331-345 (15) ITHVVSSTMMAGLLR PA
0
352-361 (10) LCQEPGEEER PA
0
362-416 (55) EIQFHSDPLSAINACFEGDTVIVCPGHYVVHGTFSIADSIELEGYGLPDDIVIEK PA
0
420-432 (13) GDTFVDCTGADIK PA
0
438-452 (15) FVQHDAVEGILIVHR PA
0
455-472 (18) TTLENCVLQCETTGVTVR PA
0
473-480 (8) TSAEFLMK PA
0
481-488 (8) NSDLYGAK PA
0
489-511 (23) GAGIEIYPGSQCTLSDNGIHHCK PA
0
518-528 (11) DFLDEHYDIPK PA
0
529-567 (39) ISMVNNIIHNNEGYGVVLVKPTIFSDLQENAEDGTEENK PA
0
571-582 (12) IQTSGEPDVAER PA
0
583-595 (13) VDLEELIECATGK PA
0
602-625 (24) TDPSEQVEGNCEIVNELIAASTQK PA
0
633-660 (28) LSELGITQADDNLMSQEMFVGIVGNQFK PA
0
665-672 (8) GSFGTFLF PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center