Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NEV9-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MGQTAGDLGWR PA
0
12-44 (33) LSLLLLPLLLVQAGVWGFPRPPGRPQLSLQELR PA
0
46-55 (10) EFTVSLHLAR PA
0
68-98 (31) FAESHLPGVNLYLLPLGEQLPDVSLTFQAWR PA
0
106-128 (23) LCFISTTLQPFHALLGGLGTQGR PA
0
153-177 (25) FQVLAAGFNLPEEEEEEEEEEEEER PA
0
179-205 (27) GLLPGALGSALQGPAQVSWPQLLSTYR PA
0
206-216 (11) LLHSLELVLSR PA
0
227-243 (17) AGHSVWPLGFPTLSPQP PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center