Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NF50-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MATLPSAER PA
1
27-39 (13) QFTLPPNLGQYHR PA
1
40-98 (59) QSISTSGFPSLQLPQFYDPVEPVDFEGLLMTHLNSLDVQLAQELGDFTDDDLDVVFTPK PA
1
102-119 (18) TLQPSLPEEGVELDPHVR PA
3
120-127 (8) DCVQTYIR PA
3
136-146 (11) NQGSPEICGFK PA
3
161-180 (20) QTFESETLECSEPAAQAGPR PA
3
181-191 (11) HLNVLCDVSGK PA
3
192-202 (11) GPVTACDFDLR PA
3
210-224 (15) LENLLQQVSAEDFEK PA
3
235-261 (27) QAELFALYPSVDEEDAVEIRPVPECPK PA
3
277-294 (18) FEIEIEPLFASIALYDVK PA
3
299-313 (15) ISENFHCDLNSDQFK PA
3
318-330 (13) AHTPSVAASSQAR PA
3
331-348 (18) SAVFSVTYPSSDIYLVVK PA
3
352-369 (18) VLQQGEIGDCAEPYTVIK PA
3
385-393 (9) LQAESFCQR PA
3
399-419 (21) MPFAWAPISLSSFFNVSTLER PA
3
420-430 (11) EVTDVDSVVGR PA
3
449-462 (14) ALSLEENGVGSNFK PA
3
463-473 (11) TSTLSVSSFFK PA
3
479-486 (8) LSDEDLFK PA
4
510-537 (28) LEISTAPEIINCCLTPEMLPVKPFPENR PA
3
543-550 (8) EILEFPTR PA
3
551-560 (10) EVYVPHTVYR PA
3
561-569 (9) NLLYVYPQR PA
3
586-604 (19) IQFMCGEDASNAMPVIFGK PA
3
605-623 (19) SSGPEFLQEVYTAVTYHNK PA
3
624-632 (9) SPDFYEEVK PA
3
639-657 (19) LTVNHHLLFTFYHISCQQK PA
3
658-678 (21) QGASVETLLGYSWLPILLNER PA
3
679-692 (14) LQTGSYCLPVALEK PA
3
693-704 (12) LPPNYSMHSAEK PA
3
705-713 (9) VPLQNPPIK PA
3
720-741 (22) GVFNIEVQAVSSVHTQDNHLEK PA
3
742-758 (17) FFTLCHSLESQVTFPIR PA
3
764-774 (11) ISEMALEHELK PA
3
775-784 (10) LSIICLNSSR PA
3
785-798 (14) LEPLVLFLHLVLDK PA
3
799-835 (37) LFQLSVQPMVIAGQTANFSQFAFESVVAIANSLHNSK PA
3
845-857 (13) NCLLASYVHYVFR PA
3
868-878 (11) SGAPTALLDPR PA
3
886-894 (9) TSAAAVSSK PA
3
900-920 (21) VMSSSNPDLAGTHSAADEEVK PA
3
927-944 (18) HFHEELALQMVVSTGMVR PA
3
950-960 (11) YAWFFFELLVK PA
3
961-971 (11) SMAQHVHNMDK PA
3
984-1008 (25) FMDDITTIVNVVTSEIAALLVKPQK PA
3
1016-1033 (18) MNISLAFFLYDLLSLMDR PA
3
1034-1041 (8) GFVFNLIR PA
3
1042-1050 (9) HYCSQLSAK PA
3
1051-1061 (11) LSNLPTLISMR PA
3
1067-1110 (44) ILCSHEHYLNLNLFFMNADTAPTSPCPSISSQNSSSCSSFQDQK PA
3
1111-1122 (12) IASMFDLTSEYR PA
3
1123-1148 (26) QQHFLTGLLFTELAAALDAEGEGISK PA
3
1153-1169 (17) AVSAIHSLLSSHDLDPR PA
3
1179-1206 (28) IAALYLPLVGIILDALPQLCDFTVADTR PA
3
1210-1239 (30) TSGSDEEQEGAGAINQNVALAIAGNNFNLK PA
3
1240-1251 (12) TSGIVLSSLPYK PA
3
1252-1262 (11) QYNMLNADTTR PA
3
1263-1273 (11) NLMICFLWIMK PA
3
1274-1281 (8) NADQSLIR PA
3
1283-1294 (12) WIADLPSTQLNR PA
3
1295-1309 (15) ILDLLFICVLCFEYK PA
3
1317-1324 (8) VSTQVLQK PA
3
1357-1365 (9) FPGLNENLR PA
3
1385-1422 (38) AELDQEALISGNLATEAHLIILDMQENIIQASSALDCK PA
3
1423-1431 (9) DSLLGGVLR PA
3
1432-1454 (23) VLVNSLNCDQSTTYLTHCFATLR PA
3
1460-1491 (32) FGDLLFEEEVEQCFDLCHQVLHHCSSSMDVTR PA
3
1492-1503 (12) SQACATLYLLMR PA
3
1504-1514 (11) FSFGATSNFAR PA
3
1517-1529 (13) MQVTMSLASLVGR PA
3
1530-1539 (10) APDFNEEHLR PA
3
1544-1580 (37) TILAYSEEDTAMQMTPFPTQVEELLCNLNSILYDTVK PA
3
1583-1597 (15) EFQEDPEMLMDLMYR PA
3
1601-1609 (9) SYQASPDLR PA
3
1610-1619 (10) LTWLQNMAEK PA
3
1625-1721 (97) CYTEAAMCLVHAAALVAEYLSMLEDHSYLPVGSVSFQNISSNVLEESVVSEDTLSPDEDGVCAGQYFTESGLVGLLEQAA
ELFSTGGLYETVNEVYK PA
3
1722-1731 (10) LVIPILEAHR PA
3
1746-1753 (8) AFDSIVNK PA
3
1772-1783 (12) FGDLDEQEFVYK PA
9
1797-1814 (18) LEAFYGQCFGAEFVEVIK PA
3
1829-1846 (18) AYIQITFVEPYFDEYEMK PA
3
1861-1874 (14) FMYTTPFTLEGRPR PA
3
1875-1882 (8) GELHEQYR PA
3
1884-1897 (14) NTVLTTMHAFPYIK PA
3
1906-1921 (16) EEFVLTPIEVAIEDMK PA
3
1924-1939 (16) TLQLAVAINQEPPDAK PA
3
1940-1973 (34) MLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPK PA
3
2023-2031 (9) ENLRPMIER PA
3
2033-2042 (10) IPELYKPIFR PA
3
2059-2067 (9) CETQLSQGS PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center