Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NF64-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-101 (101) MNSMNPMKPALPPAPHGDGSFAYESVPWQQSATQPAGSLSVVTTVWGVGNATQSQVLGNPMGPAGSPSGSSMMPGVAGGS
SALTSPQCLGQQAFAEGGANK PA
1
102-111 (10) GYVQQGVYSR PA
2
112-174 (63) GGYPGAPGFTTGYAGGPGGLGLPSHAARPSTDFTQAAAAAAVAAAAATATATATATVAALQEK PA
2
175-202 (28) QSQELSQYGAMGAGQSFNSQFLQHGGPR PA
2
203-233 (31) GPSVPAGMNPTGIGGVMGPSGLSPLAMNPTR PA
2
234-245 (12) AAGMTPLYAGQR PA
2
246-262 (17) LPQHGYPGPPQAQPLPR PA
2
268-309 (42) TYSEVYPGQQYLQGGQYAPSTAQFAPSPGQPPAPSPSYPGHR PA
2
310-334 (25) LPLQQGMTQSLSVPGPTGLHYKPTR PA
1
335-368 (34) SIPGYPSSPLPGNPTPPMTPSSSVPYMSPNQEVK PA
2
369-396 (28) SPFLPDLKPNLNSLHSSPSGSGPCDELR PA
2
403-411 (9) DGVVLEPFR PA
4
412-426 (15) LQHNLAVSNHVFQLR PA
2
432-444 (13) TLIMRPDLELQFK PA
2
452-474 (23) QMNTNWPASVQVSVNATPLTIER PA
4
479-487 (9) TSHKPLYLK PA
2
495-521 (27) NTIQITVTACCCSHLFVLQLVHRPSVR PA
4
522-529 (8) SVLQGLLK PA
4
532-541 (10) LLPAEHCITK PA
4
545-569 (25) NFSSGTIPGTPGPNGEDGVEQTAIK PA
2
592-608 (17) HIQCFDLESYLQLNCER PA
2
619-666 (48) TALLEGLEVDQYMLGILIYIQNSDYEEITIDPTCSWKPVPVKPDMHIK PA
2
667-675 (9) EEPDGPALK PA
2
679-770 (92) TVSPAHVLMPSVMEMIAALGPGAAPFAPLQPPSVPAPSDYPGQGSSFLGPGTFPESFPPTTPSTPTLAEFTPGPPPISYQ
SDIPSSLLTSEK PA
2
771-819 (49) STACLPSQMAPAGHLDPTHNPGTPGLHTSNLGAPPGPQLHHSNPPPASR PA
2
820-894 (75) QSLGQASLGPTGELAFSPATGVMGPPSMSGAGEAPEPALDLLPELTNPDELLSYLGPPDLPTNNNDDLLSLFENN PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center