Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q8NF64-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-69 (69) MNSMNPMKPALPPAPHGDGSFAYESVPWQQSATQPAGSLSVVTTVWGVGNATQSQCLGQQAFAEGGANK PA
0
70-79 (10) GYVQQGVYSR PA
2
80-142 (63) GGYPGAPGFTTGYAGGPGGLGLPSHAARPSTDFTQAAAAAAVAAAAATATATATATVAALQEK PA
2
143-170 (28) QSQELSQYGAMGAGQSFNSQFLQHGGPR PA
2
171-201 (31) GPSVPAGMNPTGIGGVMGPSGLSPLAMNPTR PA
2
202-213 (12) AAGMTPLYAGQR PA
2
214-230 (17) LPQHGYPGPPQAQPLPR PA
2
236-277 (42) TYSEVYPGQQYLQGGQYAPSTAQFAPSPGQPPAPSPSYPGHR PA
2
278-302 (25) LPLQQGMTQSLSVPGPTGLHYKPTR PA
1
303-336 (34) SIPGYPSSPLPGNPTPPMTPSSSVPYMSPNQEVK PA
2
337-364 (28) SPFLPDLKPNLNSLHSSPSGSGPCDELR PA
2
371-379 (9) DGVVLEPFR PA
4
380-394 (15) LQHNLAVSNHVFQLR PA
2
400-412 (13) TLIMRPDLELQFK PA
2
420-442 (23) QMNTNWPASVQVSVNATPLTIER PA
4
447-455 (9) TSHKPLYLK PA
2
463-489 (27) NTIQITVTACCCSHLFVLQLVHRPSVR PA
4
490-497 (8) SVLQGLLK PA
4
500-509 (10) LLPAEHCITK PA
4
513-537 (25) NFSSGTIPGTPGPNGEDGVEQTAIK PA
2
560-576 (17) HIQCFDLESYLQLNCER PA
2
587-634 (48) TALLEGLEVDQYMLGILIYIQNSDYEEITIDPTCSWKPVPVKPDMHIK PA
2
635-643 (9) EEPDGPALK PA
2
647-738 (92) TVSPAHVLMPSVMEMIAALGPGAAPFAPLQPPSVPAPSDYPGQGSSFLGPGTFPESFPPTTPSTPTLAEFTPGPPPISYQ
SDIPSSLLTSEK PA
2
739-787 (49) STACLPSQMAPAGHLDPTHNPGTPGLHTSNLGAPPGPQLHHSNPPPASR PA
2
788-862 (75) QSLGQASLGPTGELAFSPATGVMGPPSMSGAGEAPEPALDLLPELTNPDELLSYLGPPDLPTNNNDDLLSLFENN PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center